KEGG   Turneriella parva: Turpa_1957Help
Entry
Turpa_1957        CDS       T02157                                 

Definition
(GenBank) protein of unknown function DUF45
  KO
K07043  uncharacterized protein
Organism
tpx  Turneriella parva
Brite
KEGG Orthology (KO) [BR:tpx00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Turpa_1957
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF45 WLM MUG113
Motif
Other DBs
NCBI-ProteinID: AFM12604
UniProt: I4B5P7
Position
complement(1993764..1994570)
Genome map
AA seq 268 aa AA seqDB search
MTTDTDKTTNPLHSGGTALSGDAFHVEVVRSARRRTTASLKFTPQGAFVLSVPADCPESF
IRQFIESRRDWMQKARARERALHRVQAITPGSQAQYEHFVLRIEQDMHLVYPQYRVNREK
TAQAATFWLAPQFFEAANSIKLHTQLEKYLLAQLMRFGSADLIARAHELANQHQIKVKDV
FVRVQKSRLGYCTHDDRIMLNGRLLFAPQDVRDYVICHELAHTRHRNHSPAFWHYLEELF
PGARKIDKRLRDTRIYSLQVHNPEGGQQ
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgacgactgataccgacaagaccacgaacccactgcacagcggcggcacagcgctgtcg
ggcgatgcctttcacgtcgaagtcgtccgctcggcgcgtcgccgcaccactgcttcactg
aagttcaccccgcagggggcgttcgtgctttcggtaccggccgactgtcccgaaagtttt
atccggcagtttatcgaatcgcgccgcgactggatgcagaaagcaagggcgcgcgagcga
gctctgcacagggtgcaggcgattaccccgggttctcaggcgcaatacgaacattttgta
ctgcgcatcgagcaagacatgcaccttgtgtacccccaataccgcgtgaaccgcgaaaag
acagcgcaggcagcgactttctggctggcaccgcagtttttcgaagccgccaacagcata
aagctgcacacccagctcgaaaagtatctgctcgcgcaactcatgcgattcggttcagct
gatctcatcgcgcgcgcgcacgaactggcaaaccagcaccagatcaaggtcaaagatgtt
tttgtccgggtgcagaaatcgcgtctgggttattgcacgcacgacgaccgcattatgctc
aacggcaggctgctcttcgcaccgcaagacgtgcgcgactacgttatctgccatgagctg
gcgcacaccaggcaccgtaaccactcgcccgcattctggcattacctcgaagaactgttt
cctggtgcgcgcaaaatcgacaagcgcctgcgcgacacgcgtatctacagcctgcaggtt
cacaaccccgaaggtggccaacaatga

DBGET integrated database retrieval system