KEGG   Turneriella parva: Turpa_1962Help
Entry
Turpa_1962        CDS       T02157                                 

Definition
(GenBank) purine or other phosphorylase family 1
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PNP_UDP_1 DUF3110
Motif
Other DBs
NCBI-ProteinID: AFM12609
UniProt: I4B5Q2
Position
complement(2000299..2000880)
Genome map
AA seq 193 aa AA seqDB search
MLWLCVAHEKEIPGFASFSKAGFQTHALGVGQFKSLAQFSALVAQNKPARVVLAGSCGSL
DRNEVLKVFACQHFAYPSIAHEELPEFMAHCGETRRALPPMNLPAATVLQNHGLSLSAEK
FARDLGYIPTSYPRPIVENMEAASLALFCRDNGIDFTAVLCVTNVIGPDARAEWKANFRE
AGNRLRRALESLP
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgctttggctctgtgttgcgcacgagaaagaaattcccggttttgccagtttttcaaaa
gcaggatttcaaacacacgcgctgggcgtcggccagttcaaatctctggcgcaattttct
gcgctggttgcccagaacaaaccggcgcgcgtcgtgctcgcgggcagttgtggctcgtta
gatcgaaacgaggtgcttaaggtttttgcctgccagcactttgcatacccttcgatagcg
catgaagagctgcccgaatttatggcgcactgcggcgaaacccggcgtgcactgccgcca
atgaatttaccggcagcgaccgtcttgcagaatcacggcctcagtctcagcgcagaaaag
tttgcccgagatttggggtatatccccacgtcttacccgcgcccgattgtcgaaaatatg
gaggccgcctcgctcgcgctattctgccgcgataacggtatcgacttcactgccgtgctc
tgtgtaacgaacgtcatcggccccgatgcccgcgcagaatggaaggcaaactttcgtgag
gcaggcaatagattgcgcagggcgctcgagtcgctgccttga

DBGET integrated database retrieval system