KEGG   Turneriella parva: Turpa_1964Help
Entry
Turpa_1964        CDS       T02157                                 

Definition
(GenBank) protein of unknown function DUF811
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFM12611
UniProt: I4B5Q4
Position
2001604..2002656
Genome map
AA seq 350 aa AA seqDB search
MVDKKQQRKILIGKLIHLSIIMAVATVLGVFALKIILSHYKLEHKPMELGGEAKGFRTHS
RSGTYMKLANLHFRLTDEINMQVKELIGEAIPKAKGGVVNFDDVNSFRIDILSGEAFVRT
GVMEFIFNNNVFNYDGSPLKNMKMEFFDDDEGGKMVKKLRLTGDMKLVVWLGFEMIGKMY
LDREKTLMVIEAERIRSLGNPYTKTLLDAVGLNMEKLLPVPSGRGITMSGNKIIVEPFKI
FPPPQIGGFISDMRVQNDGLQLFFSSKTKVNFPPLPVKDVKNYLYLYQGDVKFGKLMMID
ARLQMVDATQKSDFDFYLKKYQLPLALGSSKIMRDGSVVATIPDYRDAIK
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacaaaaaacagcagcgtaaaattctgatcggcaagctcattcacctgagcatc
attatggctgttgcaaccgttctgggtgtttttgccctgaaaatcatactttctcactat
aagctcgagcataaaccgatggagcttggcggcgaagcgaagggctttagaacccattcg
cgctcgggtacgtacatgaagctcgccaacctgcattttcgcctgaccgacgagatcaat
atgcaggtgaaagaattgatcggcgaagcgatacccaaagcaaagggcggggtcgtcaat
ttcgacgatgtgaattcatttcgcatcgacattctctcaggtgaagccttcgtgcgcacg
ggcgtcatggaattcatcttcaacaacaatgtcttcaactacgatggttcgcccctcaaa
aacatgaagatggagtttttcgacgacgacgagggcggtaaaatggtgaaaaagttacgc
ctcaccggtgacatgaaactcgtcgtctggctgggttttgagatgatcggcaagatgtat
cttgaccgggaaaagacgctcatggtgatcgaggcagagcgcattcgctcgctcggcaac
ccgtacacgaagacgctgctcgatgccgtcggcctcaacatggaaaagctgctgcccgta
ccctctggccgaggtatcaccatgtcgggtaacaagattatcgttgagccgttcaagata
tttcccccgccgcagatcggcggattcatcagcgacatgagggtgcagaacgacggcctg
cagctcttcttttcgagcaagaccaaggtgaattttccgccattgccggtcaaagacgtt
aaaaactatctttatctctaccagggtgacgtaaaattcggtaaactcatgatgatcgac
gcgcgtctgcagatggtcgatgcgacgcaaaaaagcgattttgacttttatctgaaaaag
taccagttgcctttggcgctcggttcttcgaaaatcatgcgcgatgggtcggttgtggca
acgatacccgactaccgcgacgcaatcaagtag

DBGET integrated database retrieval system