KEGG   Turneriella parva: Turpa_1966Help
Entry
Turpa_1966        CDS       T02157                                 

Definition
(GenBank) hypothetical protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase AlaDh_PNT_C ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AFM12613
UniProt: I4B5Q6
Position
2003104..2003952
Genome map
AA seq 282 aa AA seqDB search
MRVFIVGAGAVSGGAAIAAAKAAGAEIITTTSRSEDISGADHTIHGIDLENAGAVDKMLA
DEKLRAKPVDYVIYIPARGSVGMDVTESTAEMIMPSLEYSVIPYLKLSKALKPKKTIALS
GFMALPTLTRIYGAMTFTKIAMEELAIRNPDKLQIIRIGMFLSNSVRGIAILAQRRFNKE
PGFQPEWRAEWKASGKKFPQFFYDMNYQNEENIYKAHSNGVPFRPTLPEDISKGFGMVFA
GEQAPIINVLGPWLWTENKMPELPREITSRAHLIPESIYKML
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtatttattgtcggggcgggagcagtttcaggcggagcggctatcgcagcagcc
aaagcagcgggggctgagattatcaccacgacgagtcgcagcgaagacatcagcggcgcc
gatcatacaattcacggcatagaccttgagaatgccggcgccgtcgacaaaatgctcgcc
gatgaaaagctgcgcgcgaaacctgtcgattacgtcatctatattcccgcacgcggttca
gtcggtatggatgtcaccgagtcgacagccgagatgatcatgccgagcctggaatattct
gtgattccttacctgaaactcagcaaagcgctgaagcccaagaagacgattgcgctttcg
ggctttatggcgctgccgaccctcacgcgcatctacggcgccatgacctttacgaaaatc
gcgatggaagagctggctatccgcaaccccgacaagctgcagattattcgcatcggtatg
tttctcagcaattctgtgcgcggcatcgcgattctcgcgcagcgccggttcaacaaagag
cccggctttcagcctgagtggcgcgccgaatggaaggcctcgggaaagaaatttccgcaa
tttttctatgacatgaattaccagaacgaagagaatatatacaaggcgcacagcaacggc
gtgcccttcaggccgaccctgcccgaagacatcagcaaaggttttggcatggtgttcgcc
ggcgaacaggcgccgatcatcaacgttctcggcccctggctctggacagaaaacaagatg
cctgagctgccgcgagaaatcacttcgcgcgcccacctgatacctgaatcgatctacaaa
atgctataa

DBGET integrated database retrieval system