KEGG   Turneriella parva: Turpa_1969Help
Entry
Turpa_1969        CDS       T02157                                 

Definition
(GenBank) hypothetical protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HD
Motif
Other DBs
NCBI-ProteinID: AFM12616
UniProt: I4B5Q9
Position
complement(2006047..2007372)
Genome map
AA seq 441 aa AA seqDB search
MTLKPEDNVDSGPAGDAGAETTPASGATFQFTSFKEFLQFVAYVGDDVQMEFAEPVLDAA
GAALVQKGVHMRATLQKSLQQFFDRGNLNENILIADTATLHNALRDRVCRTLLRCLEPGR
FHVAQALADASQINIRGMLASVVGRRDILPVVLKLDKSEDPILPHLGEVALVAAGLAEQY
CKHAGSGTLTREIVRNAMIGGLLHDIALADDDDFLLNDIEKISESAHAGRSAALTRQLVP
DLPAEVTDIIEHHHRTSAPYEPETDSQLSAQAIAGEALALAEYIFVQLRSQYKKDEKMNS
AELLFYDLGRAFGQGRFHPQFKKIAARLWEKLFATLHYGYEIGVVENRCPKKPSAIAYPT
PRCTQIMCHRHVTACEHYDSQFPLEVLQATRFPGRPGVMIDPGKYGKCRLAAALPKGINE
KLTADAWLRQNQQAASGEPGA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
ttgacactgaagcccgaagacaacgtcgacagcggccctgcgggtgatgccggcgctgag
actacccccgcctccggtgcgactttccagtttacaagtttcaaagaattcttacagttt
gtggcatatgtcggcgacgatgtgcaaatggaatttgcagaacccgtgctcgacgcggcc
ggcgcagcgttggtgcaaaagggcgtgcatatgcgggccactctgcaaaagagcctgcag
cagttttttgaccgcggtaatctcaacgaaaatatactgatcgcagataccgcgaccctg
cacaatgcactgcgcgatcgcgtctgccgcacgctgctgcgctgtctcgaaccgggtcgc
tttcacgtggcgcaggcgctcgccgatgcctcgcagatcaatattcgcggcatgctcgcg
agcgtcgttggccgtcgcgacatattgcccgtcgtcttgaagcttgataaatcagaagac
ccgattctgccgcatctcggcgaggtcgcgctcgttgcagcggggctcgccgagcagtac
tgcaagcatgcaggcagcggcacgctcacgcgtgagattgtgcgcaacgcaatgatcggc
ggtttgttgcatgacatcgcgctcgcagacgatgacgattttctgctgaacgatatcgaa
aaaatcagcgagagcgcgcatgcgggtcgaagcgctgccctgacgaggcaacttgttcct
gatttgcctgccgaggtgaccgacatcatcgagcaccaccaccgcacgtcggcaccgtat
gaacccgaaaccgattcgcagctatctgcgcaggcgattgccggtgaagcgcttgcactc
gcggagtatatttttgtgcagctgaggtcgcagtacaaaaaagacgaaaagatgaattca
gccgaattgctgttctacgacctcggccgggccttcggtcaggggagatttcatccgcaa
ttcaagaaaatcgccgcaaggctttgggaaaagcttttcgccacactgcactatggttat
gaaattggtgtagttgaaaaccgctgcccgaaaaaaccctcggcaattgcctacccgacg
ccgcgctgcacgcaaattatgtgtcatcgccacgtgaccgcttgcgaacactacgattcg
cagtttccgcttgaggtgctgcaggcgacgcggtttccgggtcgaccgggagtcatgatc
gacccgggtaaatatggcaagtgcaggcttgcggccgcgctgccgaagggcattaacgaa
aagctcactgcagacgcctggctcagacagaaccagcaggcagcctcaggcgagccgggc
gcgtaa

DBGET integrated database retrieval system