KEGG   Turneriella parva: Turpa_1972Help
Entry
Turpa_1972        CDS       T02157                                 

Definition
(GenBank) D-alanine--D-alanine ligase domain protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
tpx  Turneriella parva
Pathway
tpx00473  D-Alanine metabolism
tpx00550  Peptidoglycan biosynthesis
tpx01100  Metabolic pathways
tpx01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Turpa_1972
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Turpa_1972
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Turpa_1972
Enzymes [BR:tpx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Turpa_1972
Peptidoglycan biosynthesis and degradation proteins [BR:tpx01011]
 Precursor biosynthesis
  Amino acid ligase
   Turpa_1972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C ATP-grasp_3 ATP-grasp_4 GARS_A Dala_Dala_lig_N
Motif
Other DBs
NCBI-ProteinID: AFM12619
UniProt: I4B5R2
Position
complement(2009730..2010734)
Genome map
AA seq 334 aa AA seqDB search
MRVLVAFDFPTALPKNGDYRSLLHAEDWRPTRNVMEAIARLGHEPILQGVYDDILPLVFT
IKRKKPDIVFNLLESFRQKRHYEGALAGLFDLLQVPYTGCSAEALTICRNKSYTKLLLRH
TKIKFPRSVVFPRGKTNRSIKDLKFPVIVKPLGLEGSDGISQASFVADEAACIERVKTLH
ETYEVDALAEEYIEGREIYAGVLGLEKLTALPLREMLFTNFPEDRPKFATFHAKWNPEFR
KKWGIKNTFAKGIDEKTQADIEQISKSAFRALGLSGFARLDLRLTDKNEIFVLEVNPNPN
IANDDEIAYASQRLGISYDQLIQKLLDYGKRRRG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgagagttctggtcgcgttcgattttccgacggcattgccgaaaaacggcgattaccgt
tcactgttgcatgccgaagactggcggccgacgcgcaacgttatggaagcaatcgctcgc
ctcgggcacgaaccgattctgcagggagtctatgacgacattctgccgctcgtcttcacg
attaaacgcaagaagcccgacatcgtctttaacctgctcgaatcttttcgccagaaacga
cactacgagggggcgcttgcgggcctctttgatttgttgcaggtaccgtacaccggttgt
tctgccgaagcgcttaccatttgccgcaataagtcttataccaaacttctgctcaggcac
acgaagattaaatttccacggtcggttgtgtttccgcgcggcaagacgaaccgttcgatc
aaagacctcaagtttccggtgatcgtgaagccgctcggtctcgaaggctctgacggcatt
tcgcaggcttcgttcgttgccgacgaggctgcctgcatcgagcgcgtcaagacgctgcac
gaaacctacgaggtcgacgcgctcgccgaagaatacattgaaggccgcgaaatttatgca
ggcgttttagggctcgaaaagctcacggcgctgccgctgcgcgagatgctgttcacgaac
tttcccgaagacaggcccaaattcgcgacctttcatgcgaagtggaaccctgaatttcgc
aaaaaatggggtatcaagaataccttcgccaaaggcatagacgaaaaaacccaggcggat
atagaacagattagcaagtcggcgtttcgtgcgctcggcctttcgggctttgcgaggctc
gatctgcgcctcaccgacaagaatgagatcttcgtgcttgaggttaaccccaacccgaat
atagcaaacgacgatgaaatcgcctacgcgtcgcagcgcctcggcatctcgtacgaccag
ctgatacaaaagctgctcgactacggcaaacgccgacgaggttag

DBGET integrated database retrieval system