KEGG   Turneriella parva: Turpa_1979Help
Entry
Turpa_1979        CDS       T02157                                 

Definition
(GenBank) Formate-tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
tpx  Turneriella parva
Pathway
tpx00670  One carbon pool by folate
tpx01100  Metabolic pathways
tpx01120  Microbial metabolism in diverse environments
tpx01200  Carbon metabolism
Module
tpx_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Turpa_1979
Enzymes [BR:tpx01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     Turpa_1979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS AAA_31 CbiA ArsA_ATPase
Motif
Other DBs
NCBI-ProteinID: AFM12626
UniProt: I4B5R9
Position
complement(2017475..2019196)
Genome map
AA seq 573 aa AA seqDB search
MRTHDGKRIRELIERNSNIPPTCQTNSVLMAPVLKHIEEIAADIGIPADALTLYGRHKAK
VPFSLYDAARAKQGKLILVTSTTPNKAGVGKTTTSVALGQGLRRLGKNAVVALREPSLGP
VFGMKGGATGGGGSQVHPTADINLHFNGDFHAITSANNLIAALADNARYYDKGNDPLKKI
LWKRALDMNDRALRSIITGLDGNGGAQETGFDITAASEIMAILCLATDYDDLARRIDNVL
VGHRVSGKPFLFSELASTGAVMALLKDAMHPNLVQSTEGVPVFVHGGPFANIAHGCNSIA
ATRLAMTYGDYAITEAGFGADLGAEKFLNIKCRNAGIEPAVTVIATTSISLKLHGGAAES
EIRKANSAALKNGLKNLERHIANLQSFGQAVVVGYNRYDFDSADEIAMVKDWCGEHGTRF
ALNDGYAKGGEGATELANEVLSVIAQNESTPLRFTYELTEKPEDKLHKVVTHIYRGKSVS
FSTRAKNTLARLAGTEAERYPVCIAKTQYSFSQDPVLVGVAENFNIHFEDIIVNSGAEFL
VAVAGDMLRMPGLPKVPQAGKISVVKGEIEGLL
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtactcatgatggcaagcggatacgtgagctgatcgagcgcaatagcaatatcccg
cccacgtgccagacaaactctgtactcatggcacctgtactaaaacacatcgaagaaatt
gccgcagacatcggcataccagccgacgcgctgacactctacggccggcacaaggccaaa
gtccccttctcgctctacgacgccgcacgcgcgaaacagggcaaactcattctcgtgacc
tcgaccacgccgaacaaggcaggcgtcggcaagacgacgacttcagtggcgctcggccag
ggtttgcgccgcctcggcaagaatgcggtcgtcgcgctgcgtgaaccgtcgctcggcccg
gtctttggcatgaagggcggtgccaccggcggtggcggctcgcaggtgcacccgactgct
gacatcaacctgcacttcaacggtgacttccacgcgatcaccagcgcgaacaacctcatc
gcggcactcgccgacaatgcgcgctactacgacaagggcaacgacccgctcaaaaaaatt
ctctggaagcgcgcgctcgacatgaacgaccgcgcgctgcgctctattattaccgggctc
gacggcaacggcggtgcgcaagagaccggcttcgacatcaccgcggcctcagaaatcatg
gcgatactctgcctcgcgaccgattacgatgatctcgcaaggcggattgataacgtgctg
gtcggtcaccgcgtatcgggtaaacctttcctcttttctgaactggcgtcgacaggtgcg
gtcatggctctgctcaaagacgcgatgcacccgaacctcgtgcaatcgaccgaaggtgta
ccggtatttgtacacggcggaccgtttgccaatattgcgcatggctgcaacagcatcgca
gcaacacgattggcaatgacctatggcgactacgccatcaccgaagctggcttcggcgca
gacctgggagcggaaaagtttctgaatattaaatgccgcaatgcaggcatcgaacccgcc
gtgacggtcattgcaaccacctcgatctcgctcaagctacacggcggggcagcagagagt
gaaatccgcaaggcaaattcggccgcactcaagaacggcctcaagaatctcgaacggcac
atcgcgaacctgcagtcgttcggccaggccgtcgttgtcggttacaaccgctacgatttt
gacagcgccgacgaaatcgcgatggtgaaggactggtgcggcgagcacggcacacgcttt
gcgctcaatgatggctatgcgaaaggcggcgaaggtgccactgaactggcgaacgaggtt
ctgagcgtcattgcgcagaacgagtcgacgccgcttcgcttcacgtacgaacttacagaa
aagcctgaggacaagctgcacaaagtcgtcacgcacatctaccgcggaaaatccgtcagc
ttcagcacgcgcgccaaaaacactctcgcacgcctagccggcaccgaagctgagcgctac
ccggtgtgcattgccaagacgcagtattcgttttcacaagacccggtgctggtcggcgtg
gcagaaaattttaatatccacttcgaagacatcatcgtgaacagcggcgcggagttcttg
gtcgcggtcgccggcgacatgctgcgcatgccgggtttgccgaaggtaccgcaggctggc
aagatcagcgtggtgaagggtgagattgaggggttgttgtag

DBGET integrated database retrieval system