KEGG   Turneriella parva: Turpa_1986Help
Entry
Turpa_1986        CDS       T02157                                 

Definition
(GenBank) hypothetical protein
  KO
K07044  uncharacterized protein
Organism
tpx  Turneriella parva
Brite
KEGG Orthology (KO) [BR:tpx00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Turpa_1986
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metal_hydrol
Motif
Other DBs
NCBI-ProteinID: AFM12633
UniProt: I4B5S6
Position
2024502..2025326
Genome map
AA seq 274 aa AA seqDB search
MQMTVRKNKDTFAEPVPAHWAGKDALQSHVLNTLSLMFPDGESFFIRSVKHFADRVTDPK
MQADIKAFVGQEMQHSMAHERFNKAVAENVGNMDWFMWLFTVPTFEWLEPFVRKNLGFEF
LHQWALSVTAAAENMTAGFAQSLFQPGELEKIKRADVRELYAWHAAEEMEHRDLAFDVLE
LVGGNNYAMRMSGMAFAYGIITAYVALGTSYLVLKDKEFPWATLPQQLVDLFTKENSLGR
VFFEGMVDYMRLNFHPSQQPMHPDALAYLEKMAS
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatgaccgtgagaaaaaataaggacacttttgccgagccggtgccggcgcactgg
gcgggcaaagacgcgctgcagagccatgtgctcaacacgctcagccttatgtttcccgat
ggtgaatctttctttattcgttcagtaaaacacttcgccgatcgtgtcaccgaccccaaa
atgcaggcggatatcaaagcgttcgtggggcaagagatgcagcacagcatggcgcacgag
cgtttcaacaaagcggtcgccgaaaacgtcggcaatatggattggttcatgtggctcttc
acggtgccgacgtttgaatggctcgaaccttttgtgcgcaaaaatctcggctttgagttt
ttgcaccagtgggcgctttcagtgactgcagccgccgagaacatgacggcgggctttgcg
cagtcgctttttcagccgggcgaacttgagaagatcaaacgcgccgatgtgcgcgagctc
tacgcctggcacgccgcagaagagatggagcaccgcgacctcgcattcgacgtgctcgaa
ctggtcggcggtaacaactatgctatgcgcatgtcgggtatggcgttcgcgtatggtatc
attaccgcgtatgtcgcgctgggtacttcatatctggtattgaaagacaaagagtttccc
tgggcgacattgccgcagcagctcgttgatctttttaccaaagagaattcactgggccgc
gtgttcttcgaaggtatggtcgactacatgcgcctgaattttcacccaagccagcagccg
atgcaccccgatgctttggcgtatctggaaaagatggcgtcgtag

DBGET integrated database retrieval system