KEGG   Turneriella parva: Turpa_1987Help
Entry
Turpa_1987        CDS       T02157                                 

Definition
(GenBank) Amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
tpx  Turneriella parva
Pathway
tpx00330  Arginine and proline metabolism
tpx00360  Phenylalanine metabolism
tpx00380  Tryptophan metabolism
tpx00627  Aminobenzoate degradation
tpx00643  Styrene degradation
tpx01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Turpa_1987
   00360 Phenylalanine metabolism
    Turpa_1987
   00380 Tryptophan metabolism
    Turpa_1987
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Turpa_1987
   00643 Styrene degradation
    Turpa_1987
Enzymes [BR:tpx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     Turpa_1987
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AFM12634
UniProt: I4B5S7
Position
complement(2025336..2026748)
Genome map
AA seq 470 aa AA seqDB search
MNKPVHAFTNDALGDDDATGIAELIRHRKLSALEVTEAAIARAQKVNSVLNAIEVPAFDA
ALYAANAPIGQAAFAGVPTFIKDNADLEGFPTRNGSRAFTAKIAAKHGDYTEQYLALGFN
VLGKSSLPEFGFNASTEFAGEHPTRNPWNTDYSAGGSSGGSAALVAAGVVPIAHANDGGG
SIRVPAACCGLVGLKPTRNRHRNNSSANSMPVNIVSEGVVTRSVRDTARFHAAMETVYKN
PQLKPIGHVEGPSKKKLRIGLVIDSINGHATCAETRTVVEDTAKLLESLGHRVEAMPLPV
PKSFIADFTLYWSMLAFLLGTFGRFVLAPDFDATKLDAFSRGLIDHYKKHILSTPMMLYR
MYRSADLYAQVMKDYDAVLSPVLGHTVPKLGHLNPETPFETLFERLTEYVAFTPLNNAAG
SPAISLPMGVSKAGLPIAVQFQAAHGDERTLLEIAFLLEAAKPFKKIMAS
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgaataagccggtacacgcctttacaaacgatgctctgggtgacgacgacgcgactggt
atcgctgagctgatcagacaccgcaaactgagtgcgcttgaagtcaccgaagctgccatc
gcgcgtgcacaaaaagtcaattcagtcttgaatgcgatagaggttcccgctttcgacgca
gcgctctatgccgccaatgccccaatcgggcaggccgccttcgcgggagtaccgacgttt
atcaaagacaacgccgatcttgaggggtttccaacacgcaacggttcgcgcgcgttcacc
gcaaagatcgcggcaaagcacggcgactacacagaacaatacctcgcactgggcttcaac
gtgctgggcaaaagctcattgcccgaatttggcttcaacgcctcgactgagtttgcgggc
gaacacccgacacgcaacccgtggaacaccgactactcagccggtggttcgtcgggcggt
tcggccgcactcgtcgccgccggtgtcgtgccgattgcgcacgcgaatgacggcggcggt
tcgattcgtgtgccggctgcatgctgcggccttgtcggactcaaaccgacacgcaaccgc
caccgcaataacagctcggcgaattcaatgccggtgaatatcgtcagcgaaggtgtggtg
acgcgatctgtcagagacactgcgcgctttcacgcggcgatggagactgtgtacaagaac
ccacagctgaaacctatcggccacgtcgaaggcccgtcgaagaaaaaactccgcatcggt
ttggtgatcgattcgatcaacggccatgccacctgcgcagaaacgcgtaccgtcgtcgaa
gacacggcaaaactgctggaatctctcggccaccgcgttgaggcgatgccgctgccagta
cccaaaagctttatcgccgatttcacgctctactggtcgatgcttgcgtttctgctcggc
acattcggcaggttcgtgctcgcgcccgactttgacgcgaccaaactcgacgcgttcagc
cgcgggcttatcgatcactataagaaacacattctttcaacgccgatgatgctctaccgc
atgtacaggtcggctgatctttacgcgcaggtgatgaaagattatgacgcggtgctatcc
cccgtgctcggacacactgtacccaaactcggacacctgaaccccgagacgccgtttgaa
accctgttcgaacgcctgaccgagtacgtcgcattcacgccgctcaacaacgccgcgggc
agcccggcaatttcgctgccgatgggcgtatcgaaagcgggtctgccgattgcggtgcag
tttcaggcggcgcacggcgacgaacgcacgctgctcgagattgcgtttttgctcgaggcg
gcgaagccgttcaagaagattatggcatcgtag

DBGET integrated database retrieval system