KEGG   Turneriella parva: Turpa_1992Help
Entry
Turpa_1992        CDS       T02157                                 

Definition
(GenBank) hypothetical protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin_7 DsbC Thioredox_DsbH Ost5
Motif
Other DBs
NCBI-ProteinID: AFM12639
UniProt: I4B5T2
Position
2029740..2030942
Genome map
AA seq 400 aa AA seqDB search
MRQILAAFMVLGASVHALADRHPVEDTLVALPASVSIGLGGTARLSVEVTIPAGHHAYLR
HANAKGMAIPIAFRAAPESGFQLAMTAQPKGVRVGDEFVLRGKGKFTLELSELAMNEFGR
TYALPVKVRLQLCGEAEPAICYMPETIEKTISVNINAPEILSRTQIDTSLAWIDNRAAAL
DAAKLKKQNVFALISDPTRCGACVQLETKVLPNAAVNKLLREKFVLYRVPKNEYSHAPIK
GRFGIPFYFVVSPEGQNLQKWVGVPGPMQFAQGIEPYGIAASGTPTATAATTNSIPLNSG
GRECAVPLKQSYAFQATQKGEFKSAGNMRFVTNASAPGTYTVLTLDRTGEIDASNSARVV
HGKLVVERYLGGSDLIFQCSAFGIAGSVEAQSLSLSVELR
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgcgacaaattttggctgcattcatggtgcttggcgcctctgttcatgcgctagctgac
cggcatccggttgaagacactttggtggcattgcccgcttcggtttcgatcgggctcggc
ggcacggcccgcctgagcgttgaggtcaccatacctgcagggcaccatgcatacctgcgc
cacgccaatgcaaaaggcatggcgataccgatcgcttttcgggccgcgccggaatcgggc
tttcagctcgcaatgactgcgcagcctaaaggtgtgcgcgtcggcgatgaattcgtgctg
cgcggcaaaggcaagtttactctcgaactatcagaactcgcgatgaatgaattcggtcgc
acttacgccttgccggtgaaggtgcgcctgcagctctgcggcgaagccgagcccgcaatc
tgttatatgcccgaaacgattgaaaagacaatttcagtgaatatcaatgcgcccgaaata
ttgagccgaacgcaaatcgacacgagcctggcttggatagacaatcgcgcagccgcattg
gacgctgcgaagctcaagaagcagaatgtcttcgcgctgatttctgacccgacgcgctgc
ggggcttgcgtgcaacttgaaacgaaggtgttgcccaatgcagcggtgaacaagctgctg
cgcgaaaaatttgtgctctaccgcgtaccgaaaaacgagtacagccatgcgccgatcaaa
ggccgtttcggcattccgttttattttgtggtttcgcccgagggccagaatctgcagaag
tgggtaggtgtgcccggcccgatgcagtttgcgcagggtattgagccctatggcattgcg
gcgagcggcacgccaacggcgaccgccgcaacaacgaactcaatccccctgaattcgggt
ggcagagagtgtgctgtgcccttgaaacaaagttatgcgtttcaagcgacacagaagggt
gaattcaagtctgcgggcaacatgcgctttgtcacgaatgcctcagcgccgggcacgtat
acggtgctgacgctcgaccgcaccggtgaaattgatgcgtcgaacagcgcgcgcgttgtt
catggcaagctcgttgtcgagcgctacctcggcggcagcgatctcatctttcagtgttca
gcgttcggtatcgccggcagcgtcgaagcgcagtcgctctcgctgagtgttgaactgcgc
tga

DBGET integrated database retrieval system