KEGG   Turneriella parva: Turpa_2000Help
Entry
Turpa_2000        CDS       T02157                                 

Definition
(GenBank) Polyribonucleotide nucleotidyltransferase
  KO
K00962  polyribonucleotide nucleotidyltransferase [EC:2.7.7.8]
Organism
tpx  Turneriella parva
Pathway
tpx00230  Purine metabolism
tpx00240  Pyrimidine metabolism
tpx03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:tpx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Turpa_2000
   00240 Pyrimidine metabolism
    Turpa_2000
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Turpa_2000
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:tpx03019]
    Turpa_2000
   03016 Transfer RNA biogenesis [BR:tpx03016]
    Turpa_2000
Enzymes [BR:tpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.8  polyribonucleotide nucleotidyltransferase
     Turpa_2000
Messenger RNA biogenesis [BR:tpx03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Turpa_2000
Transfer RNA biogenesis [BR:tpx03016]
 Prokaryotic Type
  tRNA degradation factors
   Turpa_2000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RNase_PH S1 RNase_PH_C PNPase KH_1 KH_2 KH_5
Motif
Other DBs
NCBI-ProteinID: AFM12647
UniProt: I4B5U0
Position
complement(2037349..2039463)
Genome map
AA seq 704 aa AA seqDB search
MQHDFKVHKESVDLKGQPYELETGMWARQADGSVLLRWGNMVLMANATGAKKSGEGLDFF
PMTVEYREKYYAGGRFPGGFLKRENRPSDKEILTSRVIDRPIRPLFPDNYTNEVQIFITL
LSAQKNYSADVHAITAASAALTISGLPFDGPVAGVRIARVAGKFILFPNRDEIQAADINL
ALAGTIKAVTMIEGLADEATEEDMIAAVKHGHEEIKRLCEMQLKLKAKAGKPRQEVAPAE
THTELRKQIADLGLADMKKANEIKGKFERQAAIDACKKAVLEKFKPEFAGLEKDAAEKRE
KLIKSLIADLEVDVVRDQIFHDGVRADGRKLDEIRAISIGVGVLPGTHGSALFTRGETQS
LGVLTLGTESNAQDTDDVEGESSSRFYLHYNFPPFSVGEVKRFMGPGRREIGHGKLAENS
LAAVVPDASRFPYVMRLVSEILESNGSSSMATVCSGSLALMDGGVPIKAPVAGIAMGLIT
SGEKFAVLSDIAGLEDHFGDMDFKIAGTTKGITGFQLDTKVQGISYEIMEKAIHQAKAGR
EHILKVMGEALAKPRTELKDNAPRISTLTIDRDRIGELIGPGGKNIRSIIEKTGAEINVD
DNGLVQIASNDGESARKARAMIEGQFAEAEIGKIYEGTVRKIMEFGAFIEIMPGRDGLCH
ISKVAAERIANVGDVLQEGQKVKVKVLAIDRQGKISLSIRDAEQ
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgcaacatgattttaaagttcacaaagaatcagtagacctcaaaggccagccatacgaa
ctcgaaacaggtatgtgggcccgccaggccgacggctcggtgctgctgcgctggggcaat
atggtgctcatggcgaacgcgaccggggcgaaaaaatcaggcgaaggccttgatttcttt
cccatgacggttgaataccgcgagaaatattacgccggtggccgttttcccggtggtttt
ctgaagcgcgagaatcgcccgtcagacaaagagatattgacgtcgcgcgttatcgaccgc
ccgattcggccgctttttcccgacaactacaccaacgaagtacagattttcatcacgctt
ctgagcgcgcagaaaaactacagcgctgatgtgcatgcgattacagccgcatcagcagca
ctcaccatttcaggtctgccattcgacggcccggtagcgggtgtgcgtatcgcgcgcgtg
gcaggcaagtttattcttttcccaaaccgcgatgagattcaggcggcagacattaacctc
gcgctcgcgggtacgattaaagcagtgacaatgatcgaaggtctcgccgacgaagcgacc
gaagaagacatgatcgctgcggtcaaacacggtcatgaagagatcaagcgcctctgcgaa
atgcagctgaagctcaaggcgaaagctggcaaaccgcgccaagaagtcgcacccgccgaa
acgcacaccgaactgcgcaagcaaattgccgacctcggtcttgccgatatgaaaaaggcg
aatgaaattaagggcaagttcgagcgccaggcggcaatcgacgcctgcaaaaaagcagta
cttgaaaagttcaaacctgagtttgcgggccttgaaaaagatgccgcagagaaacgcgag
aagctcattaaatcgctcattgccgaccttgaggtcgatgtcgtacgtgaccagatcttt
cacgacggcgtgcgcgccgacggacgcaagctcgacgaaattcgcgcgatcagcatcggt
gtcggcgttttgcccggcacccacggttcagcgcttttcacacgaggtgaaacacagtct
ctcggcgtgctgacgcttggcactgaaagcaatgcacaagataccgacgatgtcgaaggc
gaatcttcaagccgtttttatctgcactataactttcccccgttcagcgtgggcgaggtg
aagcgcttcatgggccctggccgtcgcgaaatcggtcacggtaaactggccgagaactcg
ctcgccgcagttgttcccgatgcgagccgtttcccgtacgtcatgcgtctcgtgtcagaa
attctcgagtcgaatggttcgtcttctatggctaccgtctgctcgggctcgctcgccctc
atggatggcggcgtgccgatcaaagcaccggtagccggtatcgcgatgggcctcattacc
tcgggtgaaaagttcgctgtactctctgatattgccggtctcgaagaccatttcggcgat
atggatttcaagattgcgggtaccacaaaaggtatcacgggctttcagctcgacaccaag
gttcagggcatcagctatgaaattatggagaaagcgattcaccaggccaaggccggccgt
gaacacattctgaaagtgatgggcgaggcgctggcgaaaccgcgtaccgaactcaaagac
aatgccccgcgcatttcaacgctgacgatcgaccgtgaccgcatcggcgaactgatcggc
cccggtggcaagaatatccgctcgatcatcgagaaaacgggcgccgaaatcaatgtcgac
gataacggcctggttcagatcgcatccaacgacggcgaatcggcacgcaaagcgagggca
atgattgaaggccagttcgctgaagccgaaattggcaaaatctatgaaggcaccgtgcgc
aaaatcatggagttcggcgcctttatcgagattatgccaggccgcgacgggctttgccat
atcagcaaagtagccgccgaacgtattgcgaacgtcggcgatgtgctgcaagaaggccag
aaagtcaaagtgaaagttctggcgatagaccgccagggcaaaatttcgctttccattcgc
gacgctgaacaatag

DBGET integrated database retrieval system