KEGG   Turneriella parva: Turpa_2001Help
Entry
Turpa_2001        CDS       T02157                                 

Definition
(GenBank) SSU ribosomal protein S15P
  KO
K02956  small subunit ribosomal protein S15
Organism
tpx  Turneriella parva
Pathway
tpx03010  Ribosome
Module
tpx_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    Turpa_2001
Ribosome [BR:tpx03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    Turpa_2001
  Bacteria
    Turpa_2001
  Archaea
    Turpa_2001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S15
Motif
Other DBs
NCBI-ProteinID: AFM12648
UniProt: I4B5U1
Position
complement(2039544..2039810)
Genome map
AA seq 88 aa AA seqDB search
MLATAEKKALIATHQKSSKDTGSVEVQVALLTEKINRLTGHFQAHVKDHHSRVGLLKMVG
RRRRLLDYLRKNSVDRYKAIIAKLNLRK
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcaactgcagaaaagaaagcgcttatcgctacacaccagaaaagctcgaaagat
accgggtcggtagaagttcaggtagcgcttctgactgaaaaaattaaccgcctgacaggt
cactttcaggcacacgtgaaagaccaccactcacgcgtaggtctcttgaagatggtaggc
cgtcgccgccgactgctcgactacctgcgcaagaacagcgttgatcgttacaaggcgatc
attgctaaactcaatctccgtaaataa

DBGET integrated database retrieval system