KEGG   Turneriella parva: Turpa_2005Help
Entry
Turpa_2005        CDS       T02157                                 

Definition
(GenBank) hypothetical protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFM12651
UniProt: I4B5U4
Position
complement(2043161..2043856)
Genome map
AA seq 231 aa AA seqDB search
MKKKIFQNLADLRFPARPQNIDRKLLTIYQIIPPVLFMTKKSIIVAVFALFTLTACRSTR
NNYVIKEAIPKNSNIAVLVEGENDFKNAVLMEFMRGGYDVKAFNATDFYTTDDVLDVKSL
KKTAFVTNLFDPKNPQRQVAVADKVFENIYKLHIFNFENLKVEMLQSLQKKMGIRYVVLL
SLAKWDAGYTWARVIKLDNMELVYVQNYSVGRKDDLKSVVGTMIDTMQKGK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaagaaaattttccagaatctggcagatttgcgttttcctgcgcggccccagaat
attgatcgaaaactgttgacaatttatcagattataccccctgtcttattcatgacaaag
aagtccattatcgtggcggtttttgccctgttcacgctcaccgcgtgccgctcgacacgc
aacaactatgtgattaaagaggcaatccccaagaattcgaatatcgccgtgctcgtcgaa
ggcgagaacgattttaagaatgccgttttgatggaattcatgcgcgggggttatgacgtg
aaagcgttcaacgcaaccgacttttacacgaccgacgacgtgctcgatgtcaagagcctg
aaaaagacggctttcgtcaccaacctcttcgacccgaaaaacccgcagcgtcaggtggcg
gttgccgacaaggtttttgagaatatctacaaactgcatatttttaacttcgagaatctc
aaagttgaaatgctgcagtcgctgcagaaaaaaatgggcattcgctacgtcgttctgctc
tcgctcgccaaatgggatgctggttacacctgggcgcgggtgatcaagctcgacaatatg
gaactcgtgtacgtgcaaaattacagcgtgggccgcaaagacgatttgaagagcgtcgtc
ggcacgatgatcgacacgatgcaaaagggtaagtag

DBGET integrated database retrieval system