KEGG   Turneriella parva: Turpa_2006Help
Entry
Turpa_2006        CDS       T02157                                 

Definition
(GenBank) phosphopentomutase
  KO
K01839  phosphopentomutase [EC:5.4.2.7]
Organism
tpx  Turneriella parva
Pathway
tpx00030  Pentose phosphate pathway
tpx00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:tpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Turpa_2006
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Turpa_2006
Enzymes [BR:tpx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.7  phosphopentomutase
     Turpa_2006
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Metalloenzyme
Motif
Other DBs
NCBI-ProteinID: AFM12652
UniProt: I4B5U5
Position
complement(2043892..2045142)
Genome map
AA seq 416 aa AA seqDB search
MLSARVGGDKFPPVTLGIGKSIVLVIDGLGVGEQPDAYLYGPRGANTLSHIGELKPKLEI
PNLARLGLANLTYVKGWPRDEETLGFFGKITQRNEGNDSIGGHRELLGTYQEDKYLTYPK
GVPEDIMQQLMQASGRTFLGNSNDVQQGFLTKYGETHLDTGSPILLVTDDSLVHIYVHNE
KFQPDEFYLLGHTAWEVLSAHGLGRLHVHYFGGDVAGFVVDESAPVAMFHSPPRAPTLAT
TLYDAGIPVYALGKVSEMIEGAAMSETYGVKNNAECLELLNQVIRDAPTNKAKQSFVLAT
LPDLDGLYGHNRDSLGYADALESLDLQIPRLMRAMENEDMLYIVSDHGNDPTFEGTSHTR
EYVPLMVYSRMFRPRRQANLGIRASLADVAETIADSYDLNVRFAATSFWENMISQL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
gtgttgtcggcaagagtcggtggcgacaagtttccacccgtgacgctcggtatcggcaaa
tcgatagtgctcgtgatcgacggcctgggcgtgggtgagcagcccgatgcatacctttac
gggccacgcggagccaacacactttcgcacatcggcgagctcaaaccgaaactcgagatt
cccaatctggcgcgccttgggctggcgaacctgacgtatgtcaagggctggccgcgcgac
gaagagacgctgggcttttttggcaaaatcacgcagcgcaacgaaggcaacgacagcatc
ggcggccaccgggaacttctgggtacctatcaagaagacaaatacctgacgtacccgaag
ggcgtgcccgaagatattatgcagcagctgatgcaggcctcgggccgcacgtttctcggc
aattcgaacgatgtgcaacagggatttctcacgaaatatggcgaaacgcacctcgatacc
ggcagccccattctgctggtaactgacgactcgctcgtgcacatctacgtgcacaatgaa
aagtttcagcccgatgaattctatctgctcggccacaccgcatgggaggttctctcagcg
cacggcctcggcaggttgcacgtgcactattttggcggcgacgtcgcgggctttgtggtc
gacgaatctgcccccgtggcgatgttccattcgccgccgagggcgccgacactcgcaacc
acgctctacgacgcgggaattcccgtctatgcgctcggcaaggtctcagaaatgatcgaa
ggcgcggcaatgagcgaaacctatggcgtgaagaataacgccgaatgccttgaactgttg
aaccaggtgattcgcgacgcgccgacaaacaaggcaaaacaatcgttcgtgctcgcaacc
ctgcccgatcttgacggcctttatggtcacaaccgcgactcgttgggctacgccgatgcg
ctcgaatctctcgacctgcagataccgaggctcatgcgagcgatggaaaacgaagacatg
ctctatatagtctctgaccacggcaacgaccccactttcgagggcacgagccacacgcga
gaatatgtgccgctcatggtttattcgcgcatgttcagaccacgccggcaggcgaacctc
ggtatcagagcctcgctcgcagacgtcgccgagacgatcgccgacagttatgacctcaac
gtacgcttcgccgcgacaagcttttgggagaacatgatttctcagctatag

DBGET integrated database retrieval system