KEGG   Turneriella parva: Turpa_2009Help
Entry
Turpa_2009        CDS       T02157                                 

Definition
(GenBank) Lytic transglycosylase catalytic
  KO
K08309  soluble lytic murein transglycosylase [EC:4.2.2.-]
Organism
tpx  Turneriella parva
Brite
KEGG Orthology (KO) [BR:tpx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:tpx01011]
    Turpa_2009
Enzymes [BR:tpx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.2  Acting on polysaccharides
    4.2.2.-  
     Turpa_2009
Peptidoglycan biosynthesis and degradation proteins [BR:tpx01011]
 Peptidoglycan biosynthesis and degradation
  Lytic transglycosylase
   Turpa_2009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SLT
Motif
Other DBs
NCBI-ProteinID: AFM12655
UniProt: I4B5U8
Position
2047178..2049376
Genome map
AA seq 732 aa AA seqDB search
MLSKGILFAASCYLLVCCGRTSAEANLLHEYADLPGGQGVNYLSEYARAQRLKSPADRPL
QQQAYLASAFRDAAKAPICADAACAEAAIRALKGSDRSKLADYAAFHLADLAARDNQTAI
ALSLLQQISNPPDSLQRKVSLLKGRLLQLGGQAPQSAQLFREHLEKFKDGESLYLAADAF
DRAGDKSAALATAIQGLEHPEADFAFAQNGLHIRNLLGQGIYSMSAPVTRIRLMEALRVA
KDKASAHKLFSGLVNQKLSKHDRDLFVHYGSRLMIEKGDARAVQNLLASASGDFYGESGE
KAALDVCERLLKKKQYAAVNHFFATAPATKSKLQCQLRQAQRSSDYSAKARGIAAEYITS
FDAESTLAERIFLRSCLPDRSKSRSGVDIPCLEELKRITAGKVTGAGARYFLARHFDATG
NAEQVKALVTEIATQYADDYYFYRLIENPLVLQKQLIAAPASGNERSALLTATLISADLA
QARGIEVLSDLRKFTERTQKRQKKLDGPLVTAALLFAADSRDEARELLRNPERLMVYENL
VVVGQVSGKSDIALFGVKQWLREQKLRPFLYEIPLEMRQLLYPTTYAAHIEKYAAKNRVE
VAEVLALIRQESQFFAGAISRANALGLMQLLPSTAKLVAAKEGLERYNLLQPEDNIRLGT
AFMREIKDYYSADFVGLAIAYNAGPGRYTQWKKKLDPEEAVFVEQIPFQETYHYVRVLLS
DRAKYRALLTNP
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgctatctaaaggcatcttgtttgccgccagctgctatctgctcgtctgttgcgggcgc
acttctgcagaggcgaatctcttgcatgagtatgccgacctgccgggtggccagggtgtg
aattacctcagcgaatatgcgcgcgcgcagagactaaagagccctgccgaccggcctctg
cagcagcaggcctatctggcgagcgcctttcgggatgcggcgaaggcacccatctgcgcc
gatgcagcctgcgccgaggcggcaattcgcgcactaaagggctctgatcgctcaaaactc
gcggactatgcggcgtttcacctggcagacctcgctgcccgtgacaaccagaccgccatt
gctctctctctcttgcagcaaatctcgaacccacccgatagcctgcagcgaaaagtctcg
ctgctcaaaggccgcttgcttcagcttggcggccaggcgccgcagagcgcgcagctcttt
cgcgaacacctcgaaaagttcaaagacggcgagtctctgtatctggccgccgacgctttc
gaccgggcaggtgataagtcagctgcgctcgccacggcaattcagggcctcgagcacccc
gaggcagatttcgcgttcgcccaaaacggactgcacattcgcaatcttctggggcaaggt
atctacagcatgagtgcacccgttacccgcattcgcctcatggaggctctgcgcgtcgcg
aaagacaaagcgagtgcgcacaaactgttttcaggtctcgtaaaccaaaagctctcgaaa
cacgaccgcgatctcttcgtgcactacggttcacggctgatgatcgaaaaaggcgatgcg
cgtgcagttcaaaacctgctcgcttcagctagcggcgatttttatggtgaatcaggtgaa
aaggctgcactcgatgtctgtgagcgcctgttaaagaagaaacagtacgctgcggttaac
catttttttgcgactgccccagcgacgaagagcaaattacagtgccagctgcggcaggct
cagcgctcgtcagactattctgcgaaggcccgcggcatcgctgccgaatacatcacctct
ttcgatgccgagtcgaccctggcagagcgcatttttctgcgttcgtgtctgcccgacagg
tcaaaatcgcgttcgggtgtggatatcccctgtcttgaagagctgaagcgtatcacggca
ggtaaagttaccggggccggcgcgcgttatttcttggcgcggcattttgacgcaaccggc
aatgcagagcaggtaaaggcgctcgtcacagaaattgcgacgcaatatgccgatgactac
tatttctatcgcctgatcgaaaatccgctggtgctgcagaaacaactgatcgcggcacct
gcctctggtaacgaacgctctgcgctgctgacggcgacgctcatcagcgccgatctcgcg
caagcacgcggcattgaagtcttgagtgacctgcgcaaattcaccgagcgcacgcagaaa
cgccagaaaaaactcgacggccctctcgtcactgcggcgctgcttttcgcagctgacagc
cgcgacgaggcgcgcgaactcttgcgcaaccccgaaaggctgatggtctatgaaaacctc
gttgttgtgggccaggtctctggcaagagcgacattgctctttttggggtgaagcaatgg
ctgcgcgaacagaagctacgaccgtttctttatgagatcccccttgaaatgaggcagttg
ctctacccgacgacctacgcagcacacattgaaaaatatgcggcaaaaaaccgtgtcgag
gttgccgaagtgctcgcgctcattcggcaagagtcgcagttctttgcaggggcgatcagc
cgcgcgaatgccttggggctgatgcagttgttgccctcgacagcaaagctcgtcgccgcg
aaagaaggccttgagcgatacaacctgcttcaacccgaagacaacattcgcctcggcact
gcgttcatgcgcgagatcaaagattattactcagcagatttcgtgggccttgcgatcgcg
tacaacgcgggcccgggccggtatacacagtggaaaaagaagctcgaccctgaagaggct
gtttttgtcgagcagataccgtttcaagaaacctaccattatgtacgcgtgctgctgagc
gaccgggcgaaataccgcgcgctgctgacaaacccatga

DBGET integrated database retrieval system