KEGG   Turneriella parva: Turpa_2010Help
Entry
Turpa_2010        CDS       T02157                                 

Definition
(GenBank) cyclic nucleotide-binding protein
  KO
K07001  NTE family protein
Organism
tpx  Turneriella parva
Brite
KEGG Orthology (KO) [BR:tpx00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Turpa_2010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Patatin cNMP_binding
Motif
Other DBs
NCBI-ProteinID: AFM12656
UniProt: I4B5U9
Position
2049373..2051235
Genome map
AA seq 620 aa AA seqDB search
MNQKKILGVARHSALFRSLSDAQLSRVLKHFRLHHLQKGDYLFRADQHSRMMYFVVDGKL
RVEKVIGAGQPVRIASLLAGDIVGEVAMLTGERHSGQVRAVTDAHIAGITKKELDPLLRH
YPLLLQNLIRIEALRLRHNIVREPKLNQELGFILHLYSCTPADYLAAEPNTTAAIAAQKL
KNFMLFPREFLKRAGASTDALRKAISQTLMKHPSAYLTVNAATTEGHLVKALISMADRLI
VTCSEDEASVKTAELYLRQAEQKGMQSQLRPMVINVHHASRDNLTTSEIEARLKHNVRFR
LKLRRDYWENSESPALKIQAMAIARSICENSQGIAFGGGGARALSEIGVISELERHHIAF
DHVSGTSMGSLVAALYAQGLNAREMSEKFKEFLPSDKGLLRYNLPFISFFRDRSVNRILR
RVFGNARIEDQPLPLTIIAADLISGQEIRLTRGLIWRAVRASMSLPVVFPPVRYHGAYLV
DGGAINNVPGNVLREQGVERVLGINCTPLEDNSIREYLIETNLFQLLKPGDKFWNNLKRV
FKALRLFVTRPPILQIANRAMMLEGSELIRQKSREFDLLFSPDVSRFGMFEFDRREEIID
AGRVYARLHAADLKRIFRKS
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagaaaaagattttgggtgtcgcgcgccacagtgcgctgtttcgctcgctgagc
gacgcgcagctcagccgggtgttgaagcactttcggctgcaccatctgcaaaaaggcgat
tatctgtttcgcgccgaccagcatagccgcatgatgtatttcgtcgtcgatggcaagttg
cgggtcgaaaaagtcatcggcgcgggccagccggtgcgcatcgcttcgttgcttgccggc
gacatcgtcggtgaagtcgcgatgctcacaggcgaacgccattcggggcaggtgcgcgcg
gtcaccgatgcgcatatcgcgggcatcaccaagaaagagcttgatccgctgctgaggcat
tacccgttattgttgcagaatcttattcgcatcgaagcgctgaggcttcggcacaacatc
gtgcgcgaacctaagctgaatcaagaattgggattcatattgcatctgtacagttgcacc
cctgcagattatctggcggcagagcccaacactaccgcggcgatcgccgcgcagaaactc
aagaatttcatgttgtttccgcgcgagttcttgaagcgcgcaggcgcgtcgaccgacgcg
ctgcgcaaggcgattagccagaccttgatgaagcacccctcggcctacctgaccgtcaat
gcggcaacaaccgaggggcacctagttaaggcgctcatttcgatggctgaccggttgatc
gtgacttgctcagaagacgaggcttcggtcaagacggctgaactctatttgcgtcaggca
gaacaaaagggcatgcagtcccaactgcggccgatggtgataaatgttcaccatgcttcg
cgcgacaacctcacgacttcggaaattgaggcgaggcttaaacacaacgtgcgtttcaga
ttgaaactaaggcgcgactattgggaaaactctgaatcgccggcgctcaaaattcaggcg
atggccattgcaaggtcgatctgtgaaaactcgcagggcatcgcattcggcggtggcggc
gcccgggcgctcagcgagattggtgtgatctcagagctcgaacgacaccacattgcattc
gaccatgtgtcaggcacgagcatgggttcgctggttgcagcgctctatgcgcagggactc
aatgcgcgcgaaatgagcgaaaagttcaaagagttcttgccgagcgacaaagggttactg
cgctataatctgccgtttatttcgttctttcgcgaccgcagcgtgaaccgcattctgcgg
cgggtctttggcaatgcgcgcatcgaagaccagcctctgcctctgacaattatcgccgcc
gatctgatttcaggccaggagatcaggctgacgcgtggtctcatttggcgcgccgtgcgc
gcgagcatgagcctgccggtggtttttcccccggtgcggtaccacggggcctatctcgtc
gacggtggcgcgatcaacaatgtgccgggcaatgtcttacgcgaacagggtgtcgaacgc
gtgctcggcatcaactgcacaccgctcgaagacaattccattcgcgaatatctgatcgaa
acaaatctctttcaacttttgaagcccggcgacaaattctggaacaacctcaagcgcgta
ttcaaggcattgcgcctttttgtgacacgcccgccgattctgcaaatcgccaaccgcgca
atgatgctcgagggctcagagctgatacgccagaaatcgcgcgagtttgatctgctgttt
agcccagacgtttcgcgtttcggtatgttcgaattcgaccggcgagaagaaatcattgat
gcggggcgtgtttacgcgcgtctgcatgccgctgatctgaagagaattttccgtaagagt
tag

DBGET integrated database retrieval system