KEGG   Turneriella parva: Turpa_2011Help
Entry
Turpa_2011        CDS       T02157                                 

Definition
(GenBank) hypothetical protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VasL FUSC
Motif
Other DBs
NCBI-ProteinID: AFM12657
UniProt: I4B5V0
Position
complement(2051259..2052056)
Genome map
AA seq 265 aa AA seqDB search
MMYIWHAFKHKYNLLFLGAGLIAGLFFSWSLPLFYPVLFAAETVILIGAATNKRFQRAVG
ALEGREAEKDEIRRLRNAIYGSSSALKSKMSPAEELIRQIKQNTRQNSKASVQSGEAMLT
GLDELESNFIHLLNGYCRLDDMQKVAGSGHEAELAKLKGDLAALAPDAPAETKDALQRRI
ELVEKRAAMVKEAEANKKKFLAQIEMVEETLRYLRDQSVQVFEPEVISKQVTAVSEKMQT
TRETMLEIEKMSAGADFTLQQTRIR
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgatgtacatctggcacgcatttaagcacaagtacaacctgctgtttctgggagctggc
ctgattgcaggtctttttttcagctggtcattgccgctattctaccccgtactttttgcg
gccgaaacggtcattctgattggggccgcgaccaacaaacgatttcagcgtgccgtgggt
gccctcgaaggccgtgaagccgaaaaagacgagattcgccggctgagaaacgcgatctac
ggttcaagctcggcgctcaagagcaaaatgtcgccggcagaagaattgatccgccagatt
aaacagaacacccgccagaacagcaaagcttctgtgcaatcgggtgaagcaatgctgacg
ggcctcgacgaactcgaaagcaattttattcatctgctcaatggctattgccggctcgac
gacatgcaaaaggttgcaggctcgggccacgaagccgaactcgcgaaactgaagggcgat
ctcgcggcgcttgcgcccgatgcacccgcagagaccaaagacgccctgcagcgccgcatc
gagctcgtcgagaaacgcgccgcgatggtgaaagaggccgaggcgaataagaaaaagttt
ctcgcacagattgaaatggttgaagaaaccctgcgctacctgcgcgaccagtctgtgcag
gtattcgagcccgaggtcatctctaagcaggtgacggccgtttcagaaaaaatgcagacg
acgcgcgagacgatgctcgaaatcgagaagatgtctgcgggcgcagacttcaccctgcag
cagacacgcatcagataa

DBGET integrated database retrieval system