KEGG   Turneriella parva: Turpa_2024Help
Entry
Turpa_2024        CDS       T02157                                 

Definition
(GenBank) hypothetical protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Imm63
Motif
Other DBs
NCBI-ProteinID: AFM12670
UniProt: I4B5W3
Position
2061403..2062014
Genome map
AA seq 203 aa AA seqDB search
MAQIGFTAQNYAIRVTERQGDLALYAIFRKNLLMNHLSLLQIKNLVRKKAMLISAPNNYL
PSFGKPTYDAHPHIELNNQKYHYVILERGKESERRSTPDLEEFFYWIFKAITWSMAVDFE
LSNRIIGEDCRRMIFQKQSELLGALDQNWQRRFGSETAQLLQQFPFDDVAGLRASYSGRL
RKKGFAESTIEKLAFRKFPKVVP
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaaattggctttacagcccaaaattatgccatacgcgtcaccgagcgtcaggga
gatttagccttgtacgcaatctttcgcaaaaacttactcatgaatcatttgagcctgtta
cagatcaaaaatctggtaagaaagaaggcgatgctaatttcggccccgaataattacctg
ccctcattcggcaaacccacttacgacgcgcatccccatatagaactcaataaccaaaaa
tatcactatgtaattcttgagagaggcaaagaatcggaacgtagaagcactccagacctg
gaggagtttttttactggatatttaaggcaataacctggtcaatggctgttgattttgag
ctttcaaaccggataattggcgaggattgcaggcgaatgattttccaaaagcaatcagaa
ttattgggggctttggatcagaattggcagcggaggttcggctcagaaacggcgcagtta
ttgcagcagttccctttcgatgatgtggctgggttgagagcttcttatagcgggcgcctg
agaaagaaaggctttgctgaaagtaccattgaaaaattggcatttagaaagttcccaaag
gttgtaccgtag

DBGET integrated database retrieval system