KEGG   Turneriella parva: Turpa_2030Help
Entry
Turpa_2030        CDS       T02157                                 

Definition
(GenBank) hypothetical protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFM12676
UniProt: I4B5W9
Position
complement(2066421..2067644)
Genome map
AA seq 407 aa AA seqDB search
MITRLAFAVAVTVWVFWQIPVSATREVQLPELQSVTAFDAEPNAAATAARVFFRRKSPGQ
YSAHLLSERGELVRTMQLPGQTLTKADDSKISLENKEGYITGAENGAFFIWYPQIGSQVY
MFNEQGQFLWEKDESHYLHVLPRGRYIMAAAGDHSRLTFMNPDFKTQADFQGVLFTHYLL
DDNPDLAAQACLGSLDGEVIVAHFDRRLFMRTKLGYALKSLACDFATGELAAIVEKTVTV
EKQPVQKDFLLRARFTLNAPAGAAAEETMRRVEPDIKTVASSELAVRTVTASPVALTAQT
TCFVQTNAEGFLQLFISRGAKAPPEMRALEIKDSVQAAPELSPDVWKSTTISLTGGSACL
ITHRSGHAIIADERGLLLHRRDLPVERIVKTNNGVFLQLPQGIALLK
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgattacccggctcgcgttcgccgttgccgttaccgtctgggtcttctggcagattccc
gtttcggccacgcgtgaagtgcagctgcccgagctgcagtcggttaccgcattcgacgca
gagccgaacgcggcagcgacggcggcccgcgtcttcttccggcgcaagtctccgggccag
tacagcgcgcatcttctcagcgagcgcggcgaactcgtgcgtaccatgcagctaccgggg
cagacgctcaccaaggctgacgacagcaaaatatctctcgaaaacaaagagggatatata
accggcgcagaaaatggcgcgtttttcatctggtacccccagatcggctcgcaggtttac
atgtttaacgagcagggccagtttctctgggaaaaagacgaaagccactatttgcatgtg
ttgccgcgcgggcgttacatcatggctgccgccggcgaccattcacgcctgacgttcatg
aatcctgattttaagacccaggcagattttcagggagtgctgttcacgcactatttgctc
gacgacaaccccgatcttgccgcgcaggcctgcctcggttcgctcgacggcgaagtgatt
gtcgcacacttcgaccgcaggctctttatgcgcacgaaactcggttatgcgctgaaatct
ctcgcatgcgatttcgcgacgggcgaacttgcggcaatcgtcgaaaaaaccgtcacggtt
gaaaagcagcctgtacaaaaagactttttgctgcgcgcccggtttaccctgaacgcgccg
gcgggcgctgctgccgaagagacgatgcggcgcgtcgaacctgacatcaaaacagttgcg
agctcagagctcgcggtgcgcacggtcacggcatctcccgtggcgctgactgcacagacg
acatgcttcgtgcagaccaacgccgaaggttttctgcaactctttatctcgcgcggcgcc
aaggctccgcccgagatgcgcgcgctcgaaattaaagacagcgttcaggccgcccccgaa
ctttcacccgatgtctggaaaagcaccacgatcagcctcacgggcggcagcgcatgcctt
atcacacaccggtcgggccacgctatcattgccgacgaacgcgggttactgctgcaccgg
cgcgatctgccggttgaacgcatcgtgaaaaccaacaatggcgtttttctgcaactaccg
cagggtatcgcgctgctgaaataa

DBGET integrated database retrieval system