KEGG   Turneriella parva: Turpa_2032Help
Entry
Turpa_2032        CDS       T02157                                 

Definition
(GenBank) Integrase catalytic region
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_38 rve HTH_32 HTH_23 rve_3 HTH_28
Motif
Other DBs
NCBI-ProteinID: AFM12678
UniProt: I4B8X9
Position
complement(2069611..2070576)
Genome map
AA seq 321 aa AA seqDB search
MRPYVQLSNEERLCIEESLRQGRHAGRIARDLKRHPSTIYREIRRNSMPRHYSARCAKDA
ARRRQTNTNAAKVTPELWSQIGASLKSTLSPEQIAGRMRLERFGGVCMQTIYNHIRKKSA
TSNFYRLCLRRKGKPYKRTVRIEAENKGFLRIHDLPAEALTRRKPGYWEGDLVEGKIGTG
QIATFVERHSRYTKAAKIERKLVEQFNAAARDLFADVDNSLLRGVIYDRGTEMSGYRDLQ
QVLNCGVYFCDPGSPWQRGTNENTNGLLREPFPKGTDFREIDQEQVDAALELLNNRPRKR
LNFRTPAEVYFRRSIALRFGM
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccttacgttcaactatccaatgaagaaagactgtgtatagaagaaagcctcagg
cagggccgccatgccggacgtattgccagagacctgaagcgccacccgagcaccatttat
cgtgaaatccgccgcaattcaatgccgcggcattacagcgcccgctgcgcaaaagatgca
gcgcgcaggcgccagacgaataccaacgccgcaaaggtgaccccggaactctggtcacag
atcggcgcatcgctcaaatcgacgctgtcaccggagcagatcgcggggcgtatgcggctt
gaacgcttcggcggggtttgcatgcagacgatctataatcatatccgtaagaaatccgcc
acatcgaatttctatcgcctttgcctgcgccgcaagggaaaaccatacaagcgcacagtg
cggattgaggctgaaaacaaagggtttttacgcattcacgacctgccagccgaggctttg
acgcggcgaaaacctggctattgggagggtgatttggtggagggaaaaatcggcacagga
caaatcgcaacctttgtcgaaagacattcgcgctacaccaaggcggcaaaaatcgagcgc
aaactcgttgagcagttcaacgcggctgcacgcgacctgttcgcagacgtcgataattct
ctgttacggggtgtgatttatgatcgcggcacagaaatgagcggataccgggacctgcaa
caggtgctgaattgcggagtgtatttctgcgacccaggatcgccctggcagcggggaacg
aacgaaaacaccaacggcctgctgcgcgagccatttccgaagggaacggactttcgggaa
atcgaccaggaacaggttgacgcggcgctcgaattactgaataatcggccacgcaagcga
ctgaattttcggacgccagccgaggtctactttcggaggtcgattgcacttcgttttgga
atgtaa

DBGET integrated database retrieval system