KEGG   Turneriella parva: Turpa_2035Help
Entry
Turpa_2035        CDS       T02157                                 

Definition
(GenBank) integral membrane sensor hybrid histidine kinase
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c Response_reg HisKA
Motif
Other DBs
NCBI-ProteinID: AFM12681
UniProt: I4B5X4
Position
2072942..2074705
Genome map
AA seq 587 aa AA seqDB search
MQAVIRFWAWLGDIGLGHVPEGAAQPLLRLFNRIAIISALTVILQAFSFYSLGLTYVVTV
NVAVTLAYLSLLILTYFGSFLLARVFYLMIAAFAISHHHLYFGFASGFWILLVNLTQAAF
VLYPQLRISRLLLLSIAIAACIVSIVVMSFTWAPLYDAMTPALAAKFMRGNLVRGPVLLM
LVAYYLVYENRRNEQALRFTANKATEAGNAKSFFLSNMSHELRTPMNAIKGFAEILLEAT
NGIADAKVREQFNAYLNQIRISSASLTSIIEDILDFARIETNRVTLRKVDFDLAEITRNV
MQTAQFYGNRNKEVEVKLEMADDVPRRIAGDPSRLSQVLLNLAGNAMKFTHRGFVRLRVT
LLEESPTAYCISFEVEDTGIGIPGEKLPFLFESFSQVSRETAVRYGGTGLGLAISRHLVE
MQGGKIAVMSSPGKGSVFTLTMWFEKPGEEQEAQRKGGRDLKGANILVAEDNEVNQLLVR
TLLEAWNAKVEIVDSGLNALGRAQKGGFDLILMDLQMPFMDGIEAAENIRALDDPQKSQI
PIVALTADVLSETRRKVLAAGMNDVVTKPINQAELYQSLRRALQIPE
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcggtcattcggttctgggcttggctgggtgacattggtcttgggcacgtgccc
gaaggcgcggcgcagccgctgctgcgcctctttaacagaattgcgatcatttcggccctc
acggtcattctgcaggcgttcagcttctattctctcgggttaacctatgtagtcaccgtc
aatgtcgccgttacactcgcgtatctgagcctgttgattctgacttacttcggctcattt
ctgctcgcgcgcgtcttttacctgatgatagccgcctttgcaatttcgcaccaccacctc
tatttcggctttgcttcaggtttctggatactgctcgttaacctgacgcaggccgcgttc
gtattgtacccgcagctgcgcatatcaagacttctgcttctctcgatcgcgattgccgcc
tgtatcgtttcgatcgtcgtgatgagttttacctgggcgccgctttacgatgcgatgaca
cccgctctcgcggcgaaattcatgcgcggcaatctggtgcgcgggcccgtgctgctcatg
ctcgtggcttattatctcgtctacgagaaccggcgaaacgaacaggctttgcgctttact
gcgaataaggcaaccgaagccggcaacgccaagtcgttctttctctctaacatgtcgcat
gaactgcgcaccccgatgaacgcgatcaaggggtttgccgaaatcttgctcgaggccacc
aacggcatcgccgatgcgaaagtacgcgaacagtttaacgcctacctcaaccagattcgc
atctcttcggcgagtctcacctcaatcatcgaggatattctcgattttgcccgcatcgag
acgaaccgagtcactctgcgcaaagtcgatttcgatctcgctgaaatcacgcgcaacgtc
atgcaaactgcgcagttctacggcaaccgcaataaagaggttgaagtcaaacttgagatg
gcagatgatgtgcccaggcgcattgccggtgacccttcacgcctcagccaggtgttgctg
aaccttgcgggcaatgcgatgaaattcacgcaccgtgggtttgtgcgcctcagggtaacg
ctgctcgaagaatcaccgacagcctattgcatcagttttgaagttgaagataccggtatc
ggaattcccggcgagaagctgccgtttctcttcgagagcttttcgcaggtctcgcgcgag
actgccgtgcgttacggtggcacaggtctagggctcgcgatcagccgtcacctcgtcgag
atgcagggcggcaagattgcagtcatgagcagccccggtaaaggctcagttttcacgctc
acgatgtggttcgaaaaacctggtgaagaacaagaagcccagcgcaaaggcggccgcgac
ctgaaaggggcgaacattcttgttgccgaagataacgaagtgaatcaactgctcgtgcgc
acgctgctcgaagcctggaacgccaaagtcgaaattgtggatagcggtctcaacgcactc
gggcgcgcacaaaaaggcggctttgaccttattctcatggatctgcagatgcccttcatg
gatggaatcgaagcggcagaaaatattcgtgcgctcgatgatccgcaaaaaagccagata
ccgatcgtcgcgctcacagccgacgtgctgagtgaaacccggcgcaaggtgctcgcagca
ggcatgaacgacgtcgtcacaaaaccgatcaatcaggcagaactctaccaatcgctgcgg
cgcgcgctacaaattcccgagtga

DBGET integrated database retrieval system