KEGG   Turneriella parva: Turpa_2042Help
Entry
Turpa_2042        CDS       T02157                                 

Definition
(GenBank) adenylate/guanylate cyclase
  KO
K01768  adenylate cyclase [EC:4.6.1.1]
Organism
tpx  Turneriella parva
Pathway
tpx00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:tpx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Turpa_2042
Enzymes [BR:tpx01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     Turpa_2042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_cyc HNOBA
Motif
Other DBs
NCBI-ProteinID: AFM12688
UniProt: I4B5Y1
Position
2080797..2082008
Genome map
AA seq 403 aa AA seqDB search
MFSLLKSLARAGADLDAHRNRYIINCNVFALIVIATSLPYPFIYLYLKVDIDPLLLSGSV
VFLFSYSMVIFLNFLRVHTLAKLLFFATAVCQLFGICLVFGNESGLHQFFYAAFVGVFFV
VDRHQKILLFPALLTLAAEYLLIQYINAYIDPIARLSPDTARTLNYISSGAVFTLLGAQC
LHFYWSSLRGEIDLETARHQSDKLLLNILPETIADELKRNGTVEPVEHDLVTVVFTDFVG
FTASSETRNPSDLLRQLDDCFSAFDAIIEKYNLEKLKTIGDAYMFAGGVPVDLKDNAARC
VMAAKEIIAFVDSRRTEDPRFWQIRIGVHTGRLVAGVIGRKKFIYDVWGDTVNTASRLEA
AGEPGKINTSTETYKLIKDKFSCLYRGEIAVKGKGPLAMYFVD
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgttctctttactcaaatctctggcacgtgccggcgcagacctcgatgcgcatcgaaac
cgctacatcatcaattgcaacgtgtttgcgctgatcgtcattgccacgtcgctgccatac
ccctttatctatctgtacctcaaagtcgacattgaccccttgctactttcgggcagcgtc
gtgtttctgttctcatactcgatggtgatttttctgaattttctgcgcgtgcacaccctc
gccaagctgctctttttcgcgaccgccgtctgccagttgttcggcatttgtcttgtattc
ggtaatgaatcgggtctgcaccagtttttctatgcggcgtttgttggcgtgttctttgtc
gtcgatcgccaccagaagattctgctgtttcccgcgttgctcacgcttgcggcggagtac
ctgctcatacaatacattaacgcatatattgacccgatcgccagattatcgcccgacacg
gcgcgcactttgaactacatcagctcgggcgcagtctttaccctgttgggtgcacaatgc
ctgcacttttactggagcagcctgcgcggtgagatcgacctcgaaaccgcgcgccaccag
tcagacaagctgctgctgaatatcttgcccgaaacgattgccgacgagcttaagcgcaac
ggtaccgtcgagccggtcgaacacgacctcgtgactgtggtattcaccgatttcgtcggg
tttaccgccagctctgaaactcgaaacccttctgatctgctgcggcagctcgacgattgt
ttcagcgcgtttgatgcaatcatcgaaaagtataatttggagaaactcaaaacgatcggc
gatgcctacatgtttgccggcggtgtacccgtcgaccttaaagacaacgcggcccggtgt
gtcatggccgccaaagagattatcgcgttcgttgacagcaggcgtaccgaagacccgcgc
ttctggcagattcgcatcggcgtgcacacagggcgcctcgtcgcgggagtcatcggcaga
aaaaaattcatttatgatgtctggggcgataccgtgaacacggcgagccggcttgaagca
gcgggcgagccaggtaaaattaatacatccaccgaaacgtataagctcattaaagacaag
tttagttgtttgtatcgcggtgagattgccgtgaagggcaaaggcccgcttgcaatgtat
tttgtcgattag

DBGET integrated database retrieval system