KEGG   Turneriella parva: Turpa_2046Help
Entry
Turpa_2046        CDS       T02157                                 

Definition
(GenBank) prolyl-tRNA synthetase
  KO
K01881  prolyl-tRNA synthetase [EC:6.1.1.15]
Organism
tpx  Turneriella parva
Pathway
tpx00970  Aminoacyl-tRNA biosynthesis
Module
tpx_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Turpa_2046
Enzymes [BR:tpx01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.15  proline---tRNA ligase
     Turpa_2046
Amino acid related enzymes [BR:tpx01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   Turpa_2046
Transfer RNA biogenesis [BR:tpx03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Turpa_2046
 Prokaryotic Type
    Turpa_2046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b tRNA_edit HGTP_anticodon TIR_2
Motif
Other DBs
NCBI-ProteinID: AFM12692
UniProt: I4B5Y5
Position
complement(2083531..2085348)
Genome map
AA seq 605 aa AA seqDB search
MRASQLPLFTSKNDPNDAQVASHRLLSRAGYIRKQGSGLYAYLPFGDMVHRKIEQIIREE
MNRFGGVEVTLPVITPAELWQESGRWDLMGKEMMRMQDRHEVGYALGPTHEEAMTDVARS
FLQSYKQLPINLYQIGRKYRDEIRPRYGLIRCREFVMKDAYSFHADDKSLDETYQKMREA
YRAIFERCGLKTIPVEADSGNMGGSGSEEFMVASSIGEETLLLCSDEACGYRSNQEKTAF
FENPSRGESVSAQNETASEFETGALKTIEEVAKLTGQNPRDFIKAVIFEDAQNIYLCFVQ
GDRELSEIKMKNLAGATDYWLAAEETIKAVTGAEPGYAGPVGLKYKDGENVEGTLRQAQG
DEKVMVSPSNHGKGKSADNRKTLRVFFDTHLKGRSGLITGANKTGYHTKNVAEGRDFTIS
EGHDLIVAHAGDICPQCKKAELTETRGIEVGHIFKLGKKYSEKMKLSVLDPNGKPLTPTM
GCYGIGVGRTMATSIEQNHDERGLIWHKNLTPFVVYLVSLAKSESEIAFVDQLYANLQAK
GISVYLDDRDERAGVKFNDAELVGFPFIVTVGKKSIESGKLEVKLRRSGEKLELSEAELV
QLVME
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcgtctcagctgcctctctttacctcaaaaaacgatccgaacgatgcgcaggtt
gcctcacaccgcctgctctcgcgagcggggtacattcgcaaacagggctcgggcctctac
gcatacctgccgttcggcgacatggttcaccgcaagattgaacagattattcgcgaagag
atgaaccgcttcggcggcgtcgaagtcacattgccggtgattacccccgctgaactctgg
caagaatcgggcagatgggatctcatgggcaaagaaatgatgaggatgcaagaccgtcat
gaggtcggttacgccctggggccaacgcacgaagaagcgatgaccgacgtggcgcgcagc
tttctacaatcgtacaaacagctaccgatcaacctctaccagattggccgcaaataccgc
gatgaaattcgcccgcgctacggccttattcgctgccgcgaattcgtcatgaaagacgcc
tattcgtttcatgcagacgacaagtcactcgacgaaacctaccagaaaatgcgtgaggcc
taccgcgccattttcgaaagatgcggattaaaaacgataccagtcgaggccgactcaggc
aatatgggcggcagcggttctgaagaatttatggtcgcctcgtcgatcggtgaagagacg
ttgctgctctgcagcgacgaggcgtgcggctatcgctcgaatcaagagaagactgctttc
tttgaaaatcccagcaggggcgaatctgtatccgcccaaaacgaaactgccagcgaattt
gaaaccggcgcactgaaaaccattgaagaagtcgcgaagctcacgggacaaaacccacgc
gattttatcaaagcagtcatctttgaagatgcgcagaatatctatctctgcttcgttcag
ggtgaccgcgaactctctgaaatcaagatgaagaaccttgccggcgcaaccgactactgg
ctcgcagctgaagaaactataaaagccgtcactggcgccgaaccaggctacgccgggcca
gttggcctgaagtacaaggatggcgaaaacgtcgaaggcacccttcgacaagctcagggt
gacgaaaaggtcatggtgagcccgtcgaaccatggcaagggcaagagcgcagataacaga
aaaacgcttcgcgttttctttgacacacacctcaaagggcgctcgggccttatcaccggc
gcgaacaagaccggttaccacaccaagaacgtcgccgaaggccgcgatttcactatttca
gaaggccatgacctgatcgtcgcgcatgccggggacatttgtccgcaatgtaagaaggca
gaacttaccgaaacacgcggcatagaagtcggccacatctttaagctcggtaaaaagtac
tcagaaaagatgaaactctcggtgctcgacccgaacggcaaacctctcacgccgaccatg
ggctgttacggcatcggcgtcggccgcacgatggcgacatcgatcgaacagaaccacgac
gaacgcggtctgatttggcacaagaacctgaccccttttgtggtttatctcgtgtcgctg
gcgaagagcgagagcgaaatcgcattcgttgatcagctttacgcgaaccttcaggctaaa
ggtatcagcgtttacctcgacgaccgcgacgaacgcgcgggggttaaatttaacgacgca
gagctggttggctttccgttcattgtcaccgtcggcaaaaagtcgattgaatcgggtaaa
ctcgaggtcaaactgcgccgcagtggcgaaaaactcgaactcagcgaagccgaattggtt
caactggtgatggaataa

DBGET integrated database retrieval system