KEGG   Turneriella parva: Turpa_2052Help
Entry
Turpa_2052        CDS       T02157                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
tpx  Turneriella parva
Brite
KEGG Orthology (KO) [BR:tpx00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Turpa_2052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: AFM12698
UniProt: I4B5Z1
Position
complement(2091486..2091875)
Genome map
AA seq 129 aa AA seqDB search
MPATADSEIVTEGIRVKAEPHFLAERSIPEQGQYLFTYKITLVNEGDAWAKLKSRHWIII
DSDGHREDVYGPGVVGEEPELEPGDTYTYSSFCPLSTNFGTMEGSFSMVRRDGSPFEIRV
ARFYLTVNQ
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgccggccaccgccgattcagagattgtgaccgaaggcattcgcgtgaaggcagagcct
cactttttggccgaacggtcgatacccgaacagggccagtacctgttcacgtacaaaatt
acgctcgtgaacgaaggtgatgcctgggccaaactgaaatcacgccattggattattatc
gactctgacggccaccgcgaagatgtttatgggccgggtgtcgtgggtgaagaacccgaa
ctcgaaccgggtgacacctatacctattcgagtttctgcccgctgtcgacaaacttcggc
acgatggaaggcagtttcagcatggttcgccgcgacggttcacctttcgaaatcagggtc
gcgcgtttttatctgacagtgaaccagtaa

DBGET integrated database retrieval system