KEGG   Turneriella parva: Turpa_2062Help
Entry
Turpa_2062        CDS       T02157                                 

Definition
(GenBank) MATE efflux family protein
  KO
K03327  multidrug resistance protein, MATE family
Organism
tpx  Turneriella parva
Brite
KEGG Orthology (KO) [BR:tpx00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tpx02000]
    Turpa_2062
Transporters [BR:tpx02000]
 Solute Carrier Family (SLC)
  SLC47: Multidrug and Toxin Extrusion (MATE) family
   Turpa_2062
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MatE Polysacc_synt_C
Motif
Other DBs
NCBI-ProteinID: AFM12708
UniProt: I4B601
Position
complement(2102834..2104204)
Genome map
AA seq 456 aa AA seqDB search
MISRKRSYGSFRELAPIALPIVLSQAIDVLMLFCDRLFVSQIGKEQLAATLSGGILTFMM
TTLVTGTLGQINPLVAQYRGAQRPHDATRVVHQGFVFVLFFAPAVFLISRAAAPEVFSFF
NHGGVLLSSELGYFEILSLTLFTAAIRQVFANFFIGIGETKMVTIASLTAVGLNLPLAYA
LTFGAWGLPQLGMRGAAWATVIAGFLPIGIFAARFFAADLRTLYNTRMRPRFDRNIFRQL
VRYGLPAGLETFVNVGGFTFFTMVMYSYSPDVAAATTIVLNWDMVSFLPLLGISQGASSL
VGRYLGAGKKKLALRSAWSGLKAGWGYSIIITSIYLSATVTLIVIFAPRDNLVSFDGVVA
VGKTMLRISCLYFFLDATYSVLGGILKGAGDTLWTMLVSNTAMWTAAVLVYQFKDRMGLT
AIGAWWVLTAMVSSLGLLFFWRFIQGKWLNRLMISA
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgatttcgcgaaaaagatcttacggatcattcagagagctggcgccgattgccttgccg
atcgtgctgtcgcaggcgatcgatgtgctgatgctcttctgcgaccggcttttcgtctcg
cagattggcaaagagcagctagcagcgacgctttcgggcggtattctcacctttatgatg
acgactctggtaacgggcacactcggccagatcaacccgctggtggcacagtaccgtggc
gcgcagaggccacacgatgcgacgcgcgtggtgcatcaggggttcgtgtttgttctgttc
tttgctcccgcagtctttttaatctcgcgcgcggcggctcccgaagttttttcttttttc
aatcacggcggagttttgctcagcagcgaactcggctattttgaaattctgagcctgacg
ctctttaccgctgccattcgccaggtctttgcaaacttcttcattggcatcggtgaaacg
aagatggtcacaatcgcttcgctgactgccgtggggctgaacctgccgctcgcttatgcc
ctgactttcggtgcatggggtctgccacagctcggcatgcgcggggcagcctgggcaaca
gtgatcgccggcttcttgcccatcggtatttttgcggcacgcttctttgccgccgacctg
cgcacgctctacaacacgcgcatgcgcccgcgtttcgaccgcaatatttttcgccagctc
gtgcgttatggtttgccagccgggcttgagacttttgtcaacgtcggcggatttaccttt
ttcacgatggttatgtacagctacagccccgacgtcgctgcggcgacaaccatcgtgctc
aactgggatatggtgtcctttttgccgctgctgggcatcagccagggggcatcaagcctc
gtcggtcgctatctcggtgccggtaaaaaaaagctcgctctgcgttcggcgtggtctggc
ctcaaggccggttggggttattccattatcatcacatctatctacctctcggccacggtg
acgctcatcgtcatctttgcgccacgcgataatctggtgtcgttcgacggagtcgtcgcc
gtcggcaaaacgatgctgcgcatctcttgcctctacttctttttggacgcaacgtacagc
gtactcggtggtattcttaagggcgccggcgacaccttatggacgatgctcgtctcaaac
acggcaatgtggactgcggctgtgctggtctaccagttcaaagaccgaatggggctgacc
gcaatcggcgcatggtgggtgctgacggcaatggtatcgagcctcggccttctgttcttc
tggcggttcattcagggcaaatggctgaaccggttaatgataagcgcttag

DBGET integrated database retrieval system