KEGG   Turneriella parva: Turpa_2064Help
Entry
Turpa_2064        CDS       T02157                                 

Definition
(GenBank) ferrochelatase
  KO
K01772  protoporphyrin/coproporphyrin ferrochelatase [EC:4.99.1.1 4.99.1.9]
Organism
tpx  Turneriella parva
Pathway
tpx00860  Porphyrin and chlorophyll metabolism
tpx01100  Metabolic pathways
tpx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Turpa_2064
Enzymes [BR:tpx01000]
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.1  protoporphyrin ferrochelatase
     Turpa_2064
    4.99.1.9  coproporphyrin ferrochelatase
     Turpa_2064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ferrochelatase DUF1467
Motif
Other DBs
NCBI-ProteinID: AFM12710
UniProt: I4B603
Position
complement(2105189..2106247)
Genome map
AA seq 352 aa AA seqDB search
MAKQQNGEAVLLINLGSPDSPKVSDVRRYLAQFLMDGYVIDVPYPIRWMIVHLFILPFRP
KRSAEAYSKIWEKDGSPLLTNTKKFAEKVQKFSRKKIYWAMRYGNPSVLHVLTTMRNAGY
TQILVAPLYPHHALSSTVTAIEEAKLHAADLKLELSFLPAFYDQKAHQTALAKLVKPAGA
KHDYVLFSYHGLPVRHITKADITGAYCLKVENCCERRNEQSMPAAAEAHKTCYRHQIIET
TNAVARIAGIKSDRYGFSFQSRLGRAEWLKPMTSEFISELPKKGIRRLAVIAPAFVADNL
ETLEEVNMQLREIFLAAGGEKFTYIPCLNDDSAWAKGFAQILSDSQKPHTRA
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atggctaaacagcagaacggcgaagccgttctgctcatcaacttaggttcacccgattcg
cctaaggtaagcgacgtgcgccgctacctggcccagtttctgatggatggttacgttatc
gacgtgccctacccgattcgctggatgatcgtacacctgtttatactgccgttcaggccg
aaacgttctgccgaagcctacagcaaaatctgggaaaaagacggttcgccgctcttaacg
aacaccaagaagttcgctgaaaaggtgcagaaattctcaagaaagaaaatctactgggca
atgcgttacggcaacccttcggtgctgcatgttctgacgacgatgcgcaatgccggctac
acgcagatactcgtggcgccgctgtatcctcaccatgcgctgtcatcgacagtcacggcg
attgaagaagcaaaactgcatgctgcagatttgaaactcgagctgagctttttgcccgct
ttttatgaccagaaggcgcaccagacggcgctcgcaaaactggtgaaacccgccggggca
aaacacgactatgtgcttttcagctaccacggtctgccggtgcggcacatcacgaaggcc
gatataaccggcgcatattgcctgaaagtcgaaaactgctgcgaacggcgcaatgagcag
agcatgcctgcagccgccgaggcgcataaaacgtgttaccgccaccagattattgagacc
acaaacgcagtggcaagaattgcgggcattaagagtgatcgttatggcttttcattccag
tcgcggctggggcgcgccgagtggttgaaaccgatgacctctgaatttatctcagagcta
cccaaaaaaggtattcgccgtctggcggtgattgcgcctgcatttgttgccgataatctt
gagacgcttgaagaggtgaatatgcaactgcgggaaatttttctcgcggccggtggcgaa
aaatttacctatatcccctgcctcaacgacgacagcgcgtgggcaaaaggtttcgcgcag
attctgagcgattcgcagaaaccgcacacgcgcgcgtaa

DBGET integrated database retrieval system