KEGG   Turneriella parva: Turpa_2066Help
Entry
Turpa_2066        CDS       T02157                                 

Definition
(GenBank) hypothetical protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFM12712
UniProt: I4B605
Position
2107428..2107919
Genome map
AA seq 163 aa AA seqDB search
MAEASVCVAGLRASCSLADHYKPAEAPWLVKPRRFCWQFGFTAVPRCIRAAMLLPALSVL
LHVDLPKKSGAGTCYIVGQQYSDRFPELVMVELSNGRDSTCFQYRFEILRDLEEGWVYYT
AELQDSRLKPLNKVEAVEVAGQKYLRIDGRAESRDDLGPVPEI
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggcggaagcaagcgtgtgcgtcgccggcctacgggcgtcgtgctctttggccgaccac
tacaaaccggcagaagcgccgtggcttgtaaagccccggcgcttctgctggcaatttggc
tttacagctgtaccccgctgcatacgcgcagccatgctgctacccgcgctctctgttctg
ttacatgtcgacctgccgaaaaaatcgggcgccggcacgtgctacatcgttgggcagcaa
tattctgatcgatttcctgagctggtgatggtcgagctttcaaacggccgagattcaacc
tgttttcaataccgcttcgaaatcttgcgcgatctcgaagaaggctgggtctattatact
gcagagttgcaagattcgcgacttaagcctctgaacaaagtcgaggccgttgaagttgcc
ggccagaaatacctgaggattgacgggcgtgctgaatcccgtgacgatcttgggcctgtg
cccgagatttga

DBGET integrated database retrieval system