KEGG   Turneriella parva: Turpa_2068Help
Entry
Turpa_2068        CDS       T02157                                 

Definition
(GenBank) response regulator receiver protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg TyeA
Motif
Other DBs
NCBI-ProteinID: AFM12714
UniProt: I4B607
Position
2110622..2111356
Genome map
AA seq 244 aa AA seqDB search
MKILVIEDDQIQHELLAAIFKPLQIEGTFCLTGEAGLERLRTHYFDAVLLDMGLPGRSGV
QVLRSIRDNPMTREMPVMVFTADKTKEMLLQCMRYGISDYIGKPFQINQFGQKMTNLRRM
LLFKKETGERGTEAKVVTERIPGVLKFVFGGVFTADSIAKTRQLYSTSLQALTRSEQILI
NLSALPGLAEAELKTFTQLLAVFAPKRPLVVAGRSYGPLINVMTDFESTLFITEDDALEH
RQYG
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattctcgtaattgaagacgaccagattcagcacgaactgctcgccgccatcttt
aaaccactgcagattgagggtaccttttgtctcacgggtgaagcagggttagagcgtttg
cgcacacactattttgacgcggtgctgctcgacatggggcttcccgggcgtagcggagtt
caggttttgaggtcgatcagagacaacccgatgacacgcgagatgccggtaatggttttt
accgccgataagacgaaagagatgctgctgcagtgcatgcgttatggcatcagcgactat
atcggtaaaccttttcagatcaaccagttcgggcagaagatgaccaacctgcgccgcatg
ctgctgtttaagaaagagacgggggagcgcggcaccgaggccaaagtcgtgaccgaacgc
atacccggggttctgaaatttgttttcggcggtgttttcaccgcagactcaatcgccaaa
acacggcagctttactcgacgtcgctgcaggcgctgacgcgcagcgagcagattctgatt
aatctttcagcgctgcctggccttgctgaggctgagctcaaaacctttacgcagcttctc
gcggtttttgccccgaagcggccgctggtggttgcgggcagaagctacggcccgctgatc
aatgtgatgaccgatttcgaatcgacgctcttcatcaccgaagacgacgctctcgagcac
cgccagtacggctga

DBGET integrated database retrieval system