KEGG   Turneriella parva: Turpa_2074Help
Entry
Turpa_2074        CDS       T02157                                 

Definition
(GenBank) hypothetical protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFM12720
UniProt: I4B613
Position
complement(2117822..2118733)
Genome map
AA seq 303 aa AA seqDB search
MPPLERPARLKQTPPTEKRIDFAVYAIRGLLILLATGVLWCGYRTVSCVSNHYGTHTVVY
KVTERKWKSTIVLESKNLETLTAWANELPSDAKVLRREKKIRSYRDIQTGTRTESYEEEE
TAETTRTQEKTSVERVKTGEREECATNYESIGSGAARKVTRCKKVPVYSDRTVTTSTAEP
TTEKRKVTKKRAIPVFEKQPVYDTEVTYRAWRWSEVRRWETEGTDLPVKPPQPVLKPAER
AANYRLSAPRTAFEVMFERSDKGDAPASTVQLLEEAEFAKIQPEQKVEFLFIPYKNTLER
KAK
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
ttgccgccactggaaaggccggcccgccttaaacaaacaccgcccacagagaagcgcatc
gactttgcggtctatgcaatacggggattgctgatactgctggcgaccggagtcctgtgg
tgcggctaccggacagtctcttgcgtttcgaatcactatgggacgcacacggttgtctac
aaggtcacggagcgcaaatggaaaagcaccattgtactggagagcaagaacctcgaaacg
ctgactgcctgggcaaacgaattgccgtctgatgcgaaagtcctgcgccgtgaaaagaaa
atccgcagttaccgcgacattcagaccggcacacgcaccgaaagctacgaagaagaagag
acagccgaaaccacgcgcactcaggagaaaacttcggttgaacgcgtgaagaccggcgaa
cgcgaagagtgcgccactaattatgaatcgataggctccggcgcggcacggaaggtcacg
cgctgcaagaaagtgccggtctactctgacaggacagtgaccaccagcaccgcggaaccg
acgacggagaagcgaaaagttacaaaaaaacgcgcaatacccgtgtttgaaaaacaacca
gtgtacgataccgaggtcacctaccgcgcgtggcgctggtcagaagtgcgccgatgggaa
accgaaggcaccgatctgcctgtgaaaccaccgcaacctgtactcaagccggctgaacgg
gcggctaactacagactatcagcgccgcgcacggcatttgaggtaatgtttgagcgcagc
gacaagggcgatgcccccgcttcgactgtgcagcttctggaagaagcagaatttgcgaag
atacaaccggagcagaaggtggaatttcttttcattccgtacaagaataccctggagcga
aaggctaagtga

DBGET integrated database retrieval system