KEGG   Turneriella parva: Turpa_2076Help
Entry
Turpa_2076        CDS       T02157                                 

Definition
(GenBank) methylmalonyl-CoA mutase
  KO
K11942  isobutyryl-CoA mutase [EC:5.4.99.13]
Organism
tpx  Turneriella parva
Brite
Enzymes [BR:tpx01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.13  isobutyryl-CoA mutase
     Turpa_2076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MM_CoA_mutase ArgK B12-binding cobW CBP_BcsQ AAA_29
Motif
Other DBs
NCBI-ProteinID: AFM12722
UniProt: I4B615
Position
complement(2119165..2122530)
Genome map
AA seq 1121 aa AA seqDB search
MKPIRFITATALFDGHDASINIIRRFLQREGAEVIHLGHNRPVHEVVIAALQEDADGIAI
SSYQGGHNEYFKYTIDLLKKAGASHIKVFGGGGGVIVDSEIKDLMAYGVERIYSPDDGRT
LGLDGMARDMIERASKTTRPPVTPGLNPGLQDLYANYGYLLSRRISQIESLSFAPELIPG
QMKVPVLGFTGSGGAGKSSLIDEFLRRFKLLYPDLKLALLSVDPTQRKTGGALLGDRLRL
NSVNDGKIFMRSLATRTDNAAISPTLKEILSFLRAEKFDLIIIESAGIGQSDTSITDLCD
FSVYVMTPEYGAATQLEKIAMLDYANMVIINKSDRVRAEDALIQVRKQYRRNHALLTQRD
EELPIHPTIANRFGDILVDDAFATLVKHLQAKQMLPASLAPAVKLESASIKDDFIPARRT
RYLSEIADSVRSYHSAAAGQANLARKLQSLYTALVTIGYEPEKSLGEALEIPASQPAEPL
VTQYNALLKEIDPQLLADLRSIGKTRANYAQETYSYKVRDKEVKVRAGTKSLSDTLIAKV
VPAPYEDWGELTKFLLSENIPGEFPYTAGVFPFKREGEDPTRMFAGEGSPERTNRRFHLI
AKGQPAARLSTAFDSITLYGENPAERPDIFGKIGNAGVSICTVDDMKKLYSGFDLSAPTT
SVSMTINGPSPTILAFFMNAAIDQQVEAYLAREGKLATAQEKIRQLYTEKNLKAPDYRDG
KPDGHNGLGLALLGVTGEKVVEPEVYANIRKATLSQVRGTVQADILKEDQAQNTCIFSTE
FSLKVMGDIQQFFIDNQVTNFYSVSVSGYHIAEAGANPITQVAFTLANGFTLAEYYLSRG
MKIDDFARNFSFFFSNGMDPEYAVIGRVARRIWAVSMRNLYKADARSQKLKYHIQTSGRS
LHAQEISFNDIRTTLQALYAIMDNCNSLHTNAYDEAVTTPTPESVRRAIAIQLIINRELG
LTKNENPLQGSYFLTRLTDLVEEAILQEFDRISDRGGVLGAMETMYQRNKIQEESLYYEK
LKTSGELPIIGVNTFLSEETEYYHGELMRSTDDEKQRQIESLAQFHAFHASESKAALDKL
RKVALRSGNVFEELVETVKSCSLGQITGALYEVGGSYRRNM
NT seq 3366 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccattcgctttatcacggccacggccttgttcgacggccacgacgcctcgatc
aatattattcgccgcttcttgcagcgcgagggtgcagaggtcatacacctgggccataac
cgcccggtacacgaagttgtgattgccgccttgcaagaagacgccgacggtatcgcgatc
agctcgtaccagggcggtcacaacgaatacttcaaatacacgatcgacctactcaaaaaa
gccggcgcctcgcacatcaaagttttcggcggcggcggcggagtgatcgtcgacagcgaa
atcaaagacctgatggcatacggcgtcgagcgtatctactcgcccgacgacggccgcact
ctcggtctcgacggcatggcgcgcgatatgatcgagcgcgcatcaaaaacgacgcgcccg
cctgtaaccccgggtttaaacccggggctacaggatctctacgcgaattatggatatttg
ctgtcccggcgcatttcacagattgaatcattatcatttgccccggaattaattccgggg
caaatgaaggtacccgtgctcggtttcaccggttcgggcggcgcgggcaagtcttcgctc
atcgatgaatttttgcgccggttcaaattactttatcccgatctgaagcttgcgctgctc
tcggttgacccaacgcagcgcaaaaccggcggcgcgctgttgggcgaccgcctgcggctg
aactcggtcaacgacgggaaaatcttcatgcgttcgcttgcgacgcgcacagacaacgcg
gcgatttcaccgacactcaaagaaattctcagcttcctgcgtgcggagaagtttgacctg
atcattattgaatcggcgggcatcggacagtctgacacctcaatcaccgacctgtgcgat
ttttcggtctatgtgatgacgcctgaatacggtgcggcgacgcagctcgagaaaatcgcg
atgctcgactatgcaaacatggtgatcatcaacaagtctgaccgggtacgcgccgaagat
gcgctgatacaggtacgtaagcaataccgtcgcaaccacgcactgctcacccaaagagac
gaagaactgccgattcacccgacgatcgccaaccgtttcggtgacatactcgtggacgat
gcctttgcaacgctggtgaaacacctgcaggcaaaacagatgttgcccgcgtcactcgca
ccggcagtaaagctcgaatctgcctcgattaaagatgattttatacctgcgcggcggaca
cgctatctttctgaaatcgccgattcggtgcgctcataccacagcgccgcagccggtcag
gccaacctggcccgtaagctgcaatcactctacactgcactggtgaccatcggttacgag
ccggaaaaatcactgggcgaagccctggaaattccggcgtcacaacccgcagagccgctc
gtgacacagtacaatgcgctcttgaaggagatcgatccacaactactggctgacctgcgt
tcgatcggcaaaacccgcgcgaactatgcgcaggaaacctacagctacaaggtgcgcgac
aaagaagtcaaagtgcgcgcggggacaaaatcgctgagcgacacgctgatcgccaaggtg
gtgcctgcaccatatgaagactggggcgagctcacgaaatttttgctcagtgaaaatatt
ccgggcgagtttccctataccgcgggtgtgtttccattcaagcgcgagggcgaagacccc
acacgcatgtttgcgggcgaaggttcgcccgagcgcacgaaccgccgctttcacctgatt
gcgaaggggcaaccggcagcccgtttgtccacggctttcgattcgatcaccctctacggt
gaaaacccggcggagcgccccgatattttcggcaagattggcaatgcaggtgtttcgatc
tgcacagtcgacgacatgaagaagctctactcgggttttgacctctcggcgccgacgaca
agtgtttcgatgacgatcaatggcccgtcgccgacgatcctggcatttttcatgaacgcg
gcaatcgaccagcaggtagaggcatacctggcacgcgagggtaagctcgccacagcacag
gaaaaaatccgccaactctacaccgaaaagaatctcaaagcgcccgactaccgtgacggc
aaacccgacgggcataatggcctgggcctggctctgctgggcgtaacgggcgaaaaggtt
gttgagcccgaagtttacgcaaacattcgcaaagcgacgctatcgcaggtgcgcggcacg
gtgcaggcagatattctcaaagaagaccaggcgcagaacacctgcatcttttctacggag
ttttcgctcaaagtcatgggcgacatacagcagttcttcatcgacaaccaggtgacgaat
ttctattcggtgagcgtctcgggttatcacattgccgaagccggcgccaacccgattacg
caggtcgctttcacgctcgcgaacggtttcacactggccgaatattatctcagccgcggc
atgaagatcgacgattttgcgcgcaacttcagcttcttcttttcgaacggcatggatccc
gagtacgcggtaatcggtcgcgttgcgaggcgcatctgggcggtttcgatgcgcaatctt
tacaaggccgatgcacgttcgcaaaaactcaagtaccacatacagacttcgggacgcagc
ctgcacgcgcaggaaatttcgttcaacgacattcgcaccacgctgcaggcgctctatgca
atcatggacaactgtaatagcctgcacaccaatgcttatgacgaagcggtgacaacgccg
acacccgaatcggtgcgtcgcgcgatcgcgattcagctgataatcaaccgcgagctaggt
ctgacgaaaaatgaaaatccgctgcaggggagttatttcttaacgcggctgactgatctc
gtcgaagaggcaatactccaggaattcgaccgcatctctgaccgtggcggcgttttgggc
gcgatggaaacgatgtaccagcgcaacaaaatacaggaagaaagtctctactacgaaaag
ctcaaaacctcgggcgagcttcccatcattggcgtgaatacctttttgagcgaagaaacc
gaatattaccacggcgagctgatgcgctcaaccgacgacgagaagcagcggcagatcgaa
tcgctcgcgcagttccatgcctttcatgcttcggagagtaaggcagcgctcgacaagctg
cgcaaggtcgcgctgcgttcgggcaatgtgtttgaagaactggtagagacagtcaagagc
tgctcactcggccagattaccggcgccctgtacgaagttggtggcagctacaggcggaat
atgtag

DBGET integrated database retrieval system