KEGG   Turneriella parva: Turpa_2077Help
Entry
Turpa_2077        CDS       T02157                                 

Definition
(GenBank) CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
  KO
K08744  cardiolipin synthase (CMP-forming) [EC:2.7.8.41]
Organism
tpx  Turneriella parva
Pathway
tpx00564  Glycerophospholipid metabolism
tpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Turpa_2077
Enzymes [BR:tpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.41  cardiolipin synthase (CMP-forming)
     Turpa_2077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf
Motif
Other DBs
NCBI-ProteinID: AFM12723
UniProt: I4B616
Position
complement(2122527..2123264)
Genome map
AA seq 245 aa AA seqDB search
MSAWLNLPNFLTIMRIVMIPFFLYYLLSKHPLDRFIALAIFFVASVTDFFDGYLARKWQQ
ESPLGRFLDPLADKALVIATLVIFILLDQAVSLWMVIVIILRDMLVTLMRYLAIRKGAEI
RTTRLGKAKTTFQMFSIGAILIILVIRSFHFDIPATYAEGRTQGKKNIEIASTMMIKAFQ
SFESSEIPKDERNKYFAESVPYFLLLITTLLTIISGLRYLYANWRVLLPPYTAVLRKRPK
PVRTA
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcatggcttaacctgcccaattttctcacaatcatgcgcattgtgatgattccg
tttttcttgtattatttactatcgaaacacccacttgaccgttttatcgccctcgcgatc
ttctttgtggcgtcggtgaccgactttttcgatgggtaccttgcccgcaaatggcagcaa
gaatcaccgctcggtcgttttcttgatcccttggccgacaaggctctcgtcatcgcgact
ctggttatttttattctgctcgaccaggcagtttcattgtggatggtcatcgttattatt
ctgcgcgatatgctcgtgacactgatgcgctatctcgcaattcgtaagggggctgagatt
cgaacgacgcgtctcggcaaagccaaaactacgtttcaaatgttttcgatcggggctatc
ctcattattctcgtcattcgttcgtttcacttcgacataccggcaacctacgccgaaggc
cgcactcaaggcaaaaagaatattgaaattgcttcaacgatgatgatcaaggcatttcag
tctttcgaatcgagcgagatacccaaagatgaacgcaacaaatactttgccgaatcggtg
ccgtacttcttgttgctgatcacgacgttactcaccatcatctcagggctgcggtacctc
tacgccaactggcgggtgctgctgcccccttacacagccgttttgagaaagcggcccaaa
cctgttcgcaccgcatga

DBGET integrated database retrieval system