KEGG   Turneriella parva: Turpa_2078Help
Entry
Turpa_2078        CDS       T02157                                 

Definition
(GenBank) hypothetical protein
Organism
tpx  Turneriella parva
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AFM12724
UniProt: I4B617
Position
complement(2123351..2124865)
Genome map
AA seq 504 aa AA seqDB search
MIAGKKKRNNSFCPRINSGAKRILTGIVLSTVFSLFADDLQLDTKVPLGLAHDGQILWIG
DAQTRELTGYDVAQKKKLATRTLAYDMRDLAYWAPNIVTVAPNYIFVINPINGDLVDKIP
LKGIADPVAIALDMHQAYIYNRADKKIHRVHMVDRLQFGSFTPEITADVRSLTFYKGFLW
AIAKDGKAYKISPSDGSQISFLPLPESSYGITFVDGGLYVARPGQVRSVDFIETENYVAA
AKRSFTIAGELELTLPWSEEVRKRESRLQLKYALLPITAHQRIAGLRADPFTRFGRWEDG
SHTSEISLPQASAERSRTHQLQFQVTLYNLTHIFNAQLIKLYFKNPELPDSIRVYLDALP
LAAADQASVEGFRKDWLAKNDGKHPIYVIAAVMKDPQMKTDTRCAIFRSLGIPSRRMKFV
DLDSRKTSEFVQVYLQPTGWVTITSRYDATKPKEFPVANNELELYSPDDLQILPRIVAGK
AGTVAAVPELMKFQKLQIITSSAE
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcaggcaaaaaaaagagaaacaactctttttgcccccgaattaattcgggggca
aaaagaatattgactggcatagttctttcaactgtattctctctctttgccgatgacctg
caactcgacaccaaggtgccgcttgggctcgcccacgacggccagattctctggataggc
gatgcccagactcgcgagctcacaggctacgatgtcgcgcagaaaaagaaactcgcaacg
cgcacactcgcgtatgacatgcgcgatctcgcatactgggcaccgaatatcgttaccgtc
gcgccgaactacatattcgtcatcaacccgatcaacggcgacctcgtcgataaaattccg
ttgaagggcatcgccgacccggtggcgatcgcgctcgatatgcaccaggcctatatctac
aatcgagccgataagaagattcaccgtgtgcacatggtcgaccgtttgcaattcgggtca
ttcactcctgaaattaccgccgacgtgcgcagcctgaccttttacaaaggtttcttgtgg
gcgattgcaaaggacggcaaagcctataagatatcgccttcagacggttcgcagatcagc
ttcttacccctgcccgaatcaagttatggaatcacgtttgtcgatggtggcttgtacgtc
gcgcggcccggtcaggttcgctcggtagactttattgaaacagaaaactacgtcgcggct
gcgaagcgcagtttcaccatcgctggtgaactcgagctcactctaccctggagcgaagag
gtgcgcaagcgagagagcaggctgcagctgaaatacgctcttttaccgatcactgcacac
cagcgcatcgcggggcttcgtgccgacccttttacgcgcttcggccgctgggaagacggt
tcgcacacgtcagaaatttcgttaccgcaggcgagcgcagagcgcagccgcacgcaccag
ctgcagtttcaggtcaccctctacaatctaacgcacatttttaatgcccaattgataaaa
ctctactttaagaaccctgaactgccagacagtatacgcgtttacctcgatgccctgccg
ctcgccgccgctgaccaggcttcggtcgaaggctttcgcaaagactggctggcaaaaaat
gacggcaagcatccgatttatgtgattgccgcagtcatgaaagacccccaaatgaagact
gacacgcgctgcgccatttttcgctctctgggtataccttcccgacgtatgaaatttgtc
gatcttgatagccgcaaaacctctgaatttgttcaggtttatctgcaaccaaccggttgg
gtgaccattacctcacgatacgatgctacaaaaccgaaagaatttccggtggcgaacaac
gagcttgaactctattctcccgatgaccttcagattttaccgcgaatcgtggccggcaag
gccggcaccgttgcggcggtacctgagctcatgaaatttcagaaattacagataataacc
agcagcgccgagtaa

DBGET integrated database retrieval system