KEGG   Turneriella parva: Turpa_2079Help
Entry
Turpa_2079        CDS       T02157                                 

Definition
(GenBank) peptidase M16 domain protein
  KO
K07263  zinc protease [EC:3.4.24.-]
Organism
tpx  Turneriella parva
Brite
KEGG Orthology (KO) [BR:tpx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tpx01002]
    Turpa_2079
Enzymes [BR:tpx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     Turpa_2079
Peptidases [BR:tpx01002]
 Metallo Peptidases
  Family M16: pitrilysin family
   Turpa_2079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M16_C Peptidase_M16 Mur_ligase_C
Motif
Other DBs
NCBI-ProteinID: AFM12725
UniProt: I4B618
Position
complement(2124862..2126301)
Genome map
AA seq 479 aa AA seqDB search
MKNKYTYFSLIFLAFALSALYAAGARATAERPWQHYVRAEMPPAKIPQVEKFNLKNGVQV
YFLKADHVPLVHMQVYVEGGAFEVPDDKLGVHSLWGETLVFSGSEELNREKLSQYMESRA
STFSFGAGAERSAFTLNSMSHYFVRDLQTTFAVLQKPAFAADDFGLLKKRVLQEFARRDE
NPAKWAALGSTKMYWGGTLRGRYATIRTVSSVNRDDIALWHQRMWRGERLSIAVTGSIDA
AELKQALDNTYGSMAVDVKSKPNPDALHVYPTAKPNALNILPKDIPQTTVIYKAPGLKHT
DANYYTLRLFDFLLGGDSFNSYLTQKIRTEKGWAYSAYSSFETDDFTGSIMLFTQTANMN
LPDVIAAIDEILAKPEAFISKDKIAEAKRSLKNKFVFLFENPVQYMKLYLQLKWDGLPEN
YLNDYAVNLDKVTEADVLRLAKQYYKPENFSILLCGPAGLYKKKSTLRPEAAQLLELEK
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaataaatacacatacttttcgttgatttttcttgcatttgcgttgagtgcgctc
tatgcagccggcgctcgtgcaaccgccgaacgaccgtggcagcactatgtgcgggccgaa
atgcccccggcgaagataccgcaggttgagaagttcaacctgaagaacggcgtccaggtc
tatttcttgaaggccgaccacgtgcctctggtgcacatgcaggtctacgttgaaggcggg
gcgttcgaagtgcccgacgacaagctgggtgttcacagcctctggggcgaaaccctcgta
ttttcaggttcagaagagcttaaccgcgaaaagctctcgcaatacatggagagccgcgcc
tcgacgttttcattcggcgccggggcagaacgttcggcctttacgctcaattcgatgtcg
cattattttgtgcgcgatctgcagacaacttttgcggtgttgcaaaaacctgcgtttgct
gccgacgattttggtctgttgaaaaagcgcgtgctgcaagaattcgcccggcgcgatgaa
aacccggcaaaatgggcggcactcggctccactaaaatgtattggggtggcacgctgcgc
gggcgctacgcaacgattcgcacggtaagctcagtgaaccgcgacgatatcgcgctctgg
caccagcgcatgtggcgtggcgaacggctatcgatcgcagtcacaggttcaatcgacgcc
gcagaactgaagcaggcgctcgacaacacttacggcagcatggcggttgatgtaaaatcg
aaaccgaaccctgacgcgctgcacgtctacccgacggcgaaacccaatgcgctgaacatc
ttaccaaaagatattccgcagacaactgtcatatacaaggcgccgggcctgaagcacacc
gacgcgaactattacacgctgcgcctcttcgatttcttgctcggcggcgactcgtttaac
tcatacctgacacagaaaattcgcactgagaaaggctgggcctactcagcatattcgagc
tttgaaaccgacgatttcaccggcagcatcatgctcttcacacaaacagcgaatatgaat
ctgcccgacgttatcgctgcaatcgacgaaattcttgcaaagccagaagcctttatcagc
aaagacaagatcgccgaagccaaacgttctctcaagaacaagtttgttttcttgtttgaa
aacccggttcaatacatgaagctctatttgcagctaaagtgggacggtctgccagaaaat
tatctgaatgattatgctgtgaatctcgacaaagtgaccgaggcggatgtattgcgtctt
gcaaaacagtattacaaaccggaaaatttcagcattctgctctgcggcccggcaggcctc
tacaagaagaaatcaacacttcggcccgaggccgcacaattgctcgaactggaaaaatga

DBGET integrated database retrieval system