KEGG   Turneriella parva: Turpa_3224Help
Entry
Turpa_3224        CDS       T02157                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
tpx  Turneriella parva
Pathway
tpx00010  Glycolysis / Gluconeogenesis
tpx00052  Galactose metabolism
tpx00500  Starch and sucrose metabolism
tpx00520  Amino sugar and nucleotide sugar metabolism
tpx00521  Streptomycin biosynthesis
tpx01100  Metabolic pathways
tpx01110  Biosynthesis of secondary metabolites
tpx01120  Microbial metabolism in diverse environments
tpx01130  Biosynthesis of antibiotics
tpx01200  Carbon metabolism
Module
tpx_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tpx00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Turpa_3224
   00052 Galactose metabolism
    Turpa_3224
   00500 Starch and sucrose metabolism
    Turpa_3224
   00520 Amino sugar and nucleotide sugar metabolism
    Turpa_3224
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Turpa_3224
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Turpa_3224
Enzymes [BR:tpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Turpa_3224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG RuvX
Motif
Other DBs
NCBI-ProteinID: AFM13863
UniProt: I4B9A6
Position
3380193..3381110
Genome map
AA seq 305 aa AA seqDB search
MQRRILGIDIGATTVKFAAVTPEGSVAHRGALPVASAGNEQFVAQLASVIARPEFSDIDQ
VGIGSPGPLDLEAGKIITSANMPGVKDLALVAELSALYPRKQIRLENDANAATLGEKYFG
AGKNLGDFAVLTLGTGVGGGCVFNGKLQRGFRGNFFEVGHVNVAGIFADEPRRCGCGSDG
CLEAYASATGIAKSYELKTGERRSAADISALAMGGDGAAIECYRTAGRALGFAMAAITQL
LNVRKFVLTGGVAVAEPLLTPTLRAAYLQQTLGVFHDSFQLIFTRGDENAGILGAAALFL
EAEES
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccgcattctcggcatcgatatcggcgccacaacggtgaagtttgccgccgtg
acgcctgagggcagcgtcgcgcatagaggggcattgcccgtcgcctcggcgggcaatgaa
caattcgtcgcacaactcgcgtcggtcatcgcgcgccccgaattctctgatatcgaccag
gttggcattggttcacctgggccgcttgaccttgaagccggcaagatcatcacctcggcg
aatatgccaggcgttaaagacttggcgctcgtcgctgaattgagcgcgttatatccgcga
aaacaaatcaggctcgaaaacgacgccaatgccgcaacgctcggcgagaaatatttcggc
gctggtaagaatctgggtgattttgcagtgctgacgctcggcaccggtgtcggcggcggt
tgcgtcttcaatggtaaacttcagcgcgggttcaggggaaatttcttcgaagtcggtcac
gtgaatgttgccggcatttttgccgacgagccacggcgctgtggctgcggcagcgacggc
tgcctcgaagcgtatgcttcggcaacgggtattgcgaaatcttatgagcttaagaccggc
gagcgcaggtctgcggcagatatatctgccctcgccatgggcggcgatggcgctgcgatc
gaatgttacagaaccgcgggcagggcgttggggtttgcgatggcggcgatcacgcaactt
ctgaatgtgcgaaaattcgttctgacaggtggtgtcgcagtcgcagagcccctgctcaca
cccacgctgcgggcagcgtatttgcagcagacgctcggggtttttcatgattcgtttcaa
ctcatctttacccggggtgatgagaacgccggcattttgggtgcggcggcactctttctg
gaggccgaagaatcatga

DBGET integrated database retrieval system