KEGG   Turneriella parva: Turpa_4001Help
Entry
Turpa_4001        CDS       T02157                                 

Definition
(GenBank) 3-oxoacid CoA-transferase, B subunit
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
tpx  Turneriella parva
Pathway
tpx00072  Synthesis and degradation of ketone bodies
tpx00280  Valine, leucine and isoleucine degradation
tpx00650  Butanoate metabolism
tpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Turpa_4001
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Turpa_4001
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Turpa_4001
Enzymes [BR:tpx01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     Turpa_4001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C IF-2B
Motif
Other DBs
NCBI-ProteinID: AFM14635
UniProt: I4BBH8
Position
4186417..4187070
Genome map
AA seq 217 aa AA seqDB search
MLDKTGIAKRIACEVKDGYYVNLGIGIPTLVSNYIPEGLNVVLQSENGLLGMGPFPYEGE
EDPDYINAGKQTITTLPGSSIFDSAMSFGMIRARKVDLTILGAMEVAENGDIANWKIPGK
MVKGMGGAMDLVASAKNIIVAMQHVNKANESKLLKRCTLPLTGVRCVKKIVTELAVIDVT
PQGFKLLETAPGVSVEQVKNATEGRLIIEGNVPEMQI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgctcgataaaacaggtatcgcaaaacgtatcgcgtgcgaggttaaagacggctactac
gtcaacctgggcattggcattccgactttggtttcgaattacataccagaaggattaaac
gtcgtactgcagtcagaaaacggccttttgggcatggggccgtttccttacgagggtgaa
gaagaccccgactacatcaacgccggcaagcagaccatcactaccctgccgggctcgtcg
atctttgactcggcgatgagcttcggcatgatacgcgcccgcaaagtcgacctgacgatt
ttgggcgcgatggaagttgcagaaaacggcgatattgcgaactggaagattcccggcaag
atggtcaagggcatgggcggcgcgatggacctcgtggcctcggccaagaacatcatcgtc
gcaatgcagcatgtgaacaaggcgaatgaatcaaaactgcttaagcgctgcacgctgcca
ctgacaggtgttcgctgcgtgaagaagatcgtgaccgaactggcagttatcgacgtgacc
cctcagggtttcaaactgctcgagactgcgccgggagtgagtgtcgagcaggtgaagaat
gccactgaaggccggttaattatcgagggcaatgtgcctgaaatgcaaatttaa

DBGET integrated database retrieval system