KEGG   Turneriella parva: Turpa_4129Help
Entry
Turpa_4129        CDS       T02157                                 

Definition
(GenBank) two component transcriptional regulator, winged helix family
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
tpx  Turneriella parva
Pathway
tpx02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tpx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Turpa_4129
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:tpx02022]
    Turpa_4129
Two-component system [BR:tpx02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   Turpa_4129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ OKR_DC_1_N FTCD_C MFA1_2
Motif
Other DBs
NCBI-ProteinID: AFM14762
UniProt: I4BBV5
Position
4345710..4346408
Genome map
AA seq 232 aa AA seqDB search
MNRQRKHIAIVEDDDSIRELLAENLKRAGYQVSAFFTAEQFERKADAGYNLLLLDIMLPG
KNGLALLKDLRASNHMLPVILLTASEQEAHTDQAFASGAIDYIIKPFNLNHLLLKIENLF
EQLRQADSGNTQSDFQIGAGRFDPQLNMVVRDKKEHKLTPSETATLLYFVENPNRIVSRE
ELQAAISATTKNLTSRNLDNYVLKFRKLFEPEPKEPVFFITIPRKGYALKRG
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaaccggcagagaaaacatatcgcgatcgtcgaagacgatgactcgattcgcgaacta
ctcgcagaaaatctcaaacgcgcaggctatcaggtttcggcgttctttaccgccgagcag
tttgaacgtaaggctgatgccggttataatctgttgctgctcgatatcatgctaccggga
aaaaacggcctcgcgctgctgaaagacttgcgtgcctcgaaccatatgttgccggtaatt
ctgttgaccgcttcggagcaagaagcccataccgatcaggcttttgcgtcgggagctatc
gactacattatcaaaccctttaatctgaaccacctgttactcaaaattgaaaatctgttt
gaacagctgcgccaggctgacagcggcaatactcaatcagattttcagatcggcgccggg
cgtttcgacccacagctgaatatggtcgtgcgcgacaagaaggagcacaagctgactcct
tctgaaacagcaactttgctctatttcgtggaaaatcccaaccggattgtttcacgtgaa
gaattgcaggccgcgatatcggcgaccacaaagaatctgacgtcgcgcaatctggataac
tacgtgttgaagtttcgtaagctatttgagcccgagccaaaagaacctgtcttctttatt
actataccacgcaaaggatacgcgctgaagcgcggatag

DBGET integrated database retrieval system