KEGG   Trueperella pyogenes TP6375: CQ11_03985Help
Entry
CQ11_03985        CDS       T03070                                 

Definition
(GenBank) metal-dependent phosphoesterase
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
tpy  Trueperella pyogenes TP6375
Brite
KEGG Orthology (KO) [BR:tpy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CQ11_03985
Enzymes [BR:tpy01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     CQ11_03985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP Rop-like
Motif
Other DBs
NCBI-ProteinID: AHU89278
Position
complement(827402..828253)
Genome map
AA seq 283 aa AA seqDB search
MIDLHTHSNYSDGTQTPAELMAAARDAGIATLGLTDHDTIAGWAAAAAAVVDTGVSLVRG
MEVTAHYNDAGTPISVHMLAYLFDPQAPELAAHRENLRTSRTTRAQHIVARLAEDLPISW
QDVVEIAGPDAVVGRPHIADALVVAGIVDSREQAFANYLSPRGKYYVRNYSPDVFDVIAW
INAAGGRAVFAHPAAVKRGKTVPLQALDAMAEAGLFGVEVHHRDNPESLRGQLAGKAEQL
GLCQFGSSDYHGAGKPNRLGEHTTDSETLKLLAQGAFLEVIHP
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgatttgcacacccattccaactactccgacggcacccagacgccggccgagctc
atggcggctgcccgagatgccggcatagccaccctcgggctgaccgaccacgatacaatc
gcaggttgggcggcagctgctgccgccgtcgttgacaccggcgtgagcctcgtgcgcggc
atggaagtcactgcgcattacaacgacgccggcaccccaatctccgtacacatgctggcc
tacctatttgatccgcaggcccccgaacttgccgcccaccgcgaaaacctgcgcacctca
cgcaccacccgcgcacaacatatcgtcgcccggctcgcagaggacctgcccatcagctgg
caagacgtcgtggagatcgctggccccgacgccgtcgtcggacggccgcacatagccgac
gcgctcgtggtggccgggatcgtggacagtcgcgagcaggcattcgcaaactatctcagc
ccgcgcggaaagtattacgtgcgcaactattcgccagacgtcttcgacgtcatcgcgtgg
atcaacgccgctggcggacgcgcagtcttcgcgcaccctgccgctgtcaaacgtggaaag
accgtgccattgcaggcactcgatgccatggcagaagcgggcctgttcggcgtcgaagtg
catcatcgcgacaaccctgaaagcctgcgcggacagctagctgggaaggccgaacagctt
gggctttgccagtttggctccagcgattaccatggagcgggaaaaccgaaccggctcggt
gagcacaccacggattcggagacgttgaagctgctcgcacagggcgcattcttggaggtt
atacacccgtga

DBGET integrated database retrieval system