KEGG   Trueperella pyogenes TP6375: CQ11_05650Help
Entry
CQ11_05650        CDS       T03070                                 

Definition
(GenBank) GlcNAc-PI de-N-acetylase
  KO
K18455  mycothiol S-conjugate amidase [EC:3.5.1.115]
Organism
tpy  Trueperella pyogenes TP6375
Brite
KEGG Orthology (KO) [BR:tpy00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CQ11_05650
Enzymes [BR:tpy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.115  mycothiol S-conjugate amidase
     CQ11_05650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PIG-L Phosphoesterase
Motif
Other DBs
NCBI-ProteinID: AHU89557
UniProt: X4QPA3
Position
complement(1192167..1193030)
Genome map
AA seq 287 aa AA seqDB search
MAERRLMAVHAHPDDESSKGAGTMAKYAQHGRVRVVTCTGGERGDILNPQLADDPTILPR
LGAIRREEMARAAEVLGVEHVWLGFVDSGMPEGPFPALDPACFARAPIADVVAALVRQIR
EFRPQVLITYDENGGYPHPDHIRTHTASMMAVAAARDPYAYPEAGEPWQVCKVYYDIAFN
RSRLEAFDSALRANGLVSPFESWLSRDSQAIQACARIEVADFFAQRDAALRAHATQIDPD
GFFFAMPRDLEVEVWPWEEFTLALTTVGRSAVQERDLFERIPGVEVV
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
gtggcagaacgcagacttatggcggttcacgctcatcccgacgacgagtcttccaagggc
gcgggcacgatggccaaatatgcgcaacatggacgggtccgagttgtcacctgcacgggc
ggcgaacgaggcgatatcctcaacccccagctggcggacgaccccacgatacttcctcgt
cttggcgcgattcggcgtgaggagatggcgcgtgcggccgaagtgctcggcgtggaacac
gtatggctcggcttcgtggactccggaatgccagagggcccattcccggctctcgatccg
gcctgcttcgcgagggccccgattgccgacgtcgtggcggcactcgtgcgccagatccgc
gagtttaggccgcaggtgttaattacttacgacgaaaacggcggctatccgcatccggat
cacattcgcacgcataccgcctcgatgatggcagtcgctgccgctcgcgacccgtatgcc
tatcctgaggcaggtgaaccgtggcaggtctgcaaggtgtactacgacatcgccttcaac
cgatcccggctggaggcctttgactcagccctgcgcgccaacggtctggtcagcccattc
gagtcgtggctgagccgggacagccaggcaatccaggcatgtgcacgtatcgaggtggcc
gattttttcgcccagcgcgacgccgccttgcgtgcccatgctacccagattgacccggac
ggattcttcttcgccatgccccgcgatctcgaggtggaggtgtggccgtgggaagaattc
acgctggcgctgaccacggttgggcgcagcgctgttcaggagcgcgatctctttgagcgc
attcccggcgtggaagtagtctag

DBGET integrated database retrieval system