KEGG   Trueperella pyogenes TP8: X956_05770Help
Entry
X956_05770        CDS       T03579                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
tpyo  Trueperella pyogenes TP8
Pathway
tpyo00770  Pantothenate and CoA biosynthesis
tpyo01100  Metabolic pathways
Module
tpyo_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:tpyo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    X956_05770
Enzymes [BR:tpyo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     X956_05770
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     X956_05770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein PspC Pyr_redox DUF4240
Motif
Other DBs
NCBI-ProteinID: AJC69627
Position
complement(1205082..1206356)
Genome map
AA seq 424 aa AA seqDB search
MRTDASGASQLGGSFVSKAPVARVLIGVCGGIAAYKVAVVVRRLRAAGIDVVVVPTPASL
DFVGKTTWEALSGHPVHVETPEGADRVVHVDTGQKSDLMLIAPATANTMAKIAVGMADNL
LTASALVATCPILMAPAMHTEMWNNLATQANVKTLAERGVEFIGPASGRLTGADTGVGRM
SEPGEIADAVLTRLGLTRAGARGDLTGTSVVISAGGTREPIDPVRFIANHSTGRMGVELA
NEASRRGADVTLVAANIEAAVRALVDPSVAIEQVSSALELAERMSAHAHKDILIMSAAVS
DYRVANASDTKLKRGEELHLDLVANPDILAGLAQNKHPGQLVIGFAAETGDSLQNYLEFG
REKARRKGADLLVINRVGFDAGFGDVETAVTIVDGQGATVAQASGTKREAAAAILNTIVE
RTNR
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
ttgagaactgacgcgtcgggagcctcccagctgggaggctctttcgtatctaaagccccg
gttgcgcgcgtcctcatcggggtgtgcggcgggatcgccgcctacaaagttgccgtcgtc
gtgcgtcggctacgcgcggcgggcatcgacgtcgtcgtggtacccaccccggcgtctttg
gatttcgtcggaaagacaacgtgggaggcactgtccggtcatcccgtccacgtcgagacg
ccggagggcgcggatcgcgtcgtccacgtcgataccggacaaaaatccgacctgatgctc
attgccccggccacggccaacacgatggcgaagatcgctgtggggatggcggataatctg
ctgacggcgtccgccctcgtggccacctgcccgatcctcatggcaccggcgatgcacact
gagatgtggaacaatctagccacccaagccaacgtcaagacgctcgcggagcgcggcgtg
gaattcatcggcccggcaagtggtcgtctgactggcgcagatactggtgtgggcagaatg
agcgaacctggagaaattgcggatgcggtcctcacccggctcggtctcacccgggccggc
gcgcgaggtgatctgaccggcacgtccgtggttatctcggcaggtggcacacgtgaacct
attgatcctgtccgtttcatcgccaatcactcgacgggacggatgggcgttgaacttgcc
aacgaggcatctcgcaggggcgcggatgtgacgctcgtggcggcgaacattgaggccgcg
gtgcgtgcgctggtcgatccaagtgtcgccatcgaacaggtctcgtcggccctcgaactg
gctgagcgcatgagcgcgcacgcccacaaggacatcctcattatgtccgcagcggtctcc
gattaccgcgtcgccaacgcttcagatacgaagctcaaacgcggggaagagctacaccta
gacctagtggcaaatcccgatattctcgcaggtctggcacaaaacaagcatccaggtcag
ctggtcattggtttcgctgctgaaactggtgactcgctacagaattatctcgagtttggc
cgcgaaaaggcgcggcgaaagggcgcggatttgctggtcatcaatcgtgtcgggttcgat
gcgggttttggcgatgttgaaactgccgtgacgattgtcgatggccaaggcgcaactgtc
gcgcaggcgtcaggcacgaagcgagaggcggccgccgccattttgaacacgattgtagag
aggacgaatcgatga

DBGET integrated database retrieval system