KEGG   Trueperella pyogenes TP8: X956_06305Help
Entry
X956_06305        CDS       T03579                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tpyo  Trueperella pyogenes TP8
Pathway
tpyo00020  Citrate cycle (TCA cycle)
tpyo01100  Metabolic pathways
tpyo01110  Biosynthesis of secondary metabolites
tpyo01120  Microbial metabolism in diverse environments
tpyo01130  Biosynthesis of antibiotics
tpyo01200  Carbon metabolism
Module
tpyo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tpyo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tpyo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    X956_06305
  09105 Amino acid metabolism
   00310 Lysine degradation
    X956_06305
   00380 Tryptophan metabolism
    X956_06305
Enzymes [BR:tpyo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     X956_06305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding
Motif
Other DBs
NCBI-ProteinID: AJC69700
Position
1323760..1324734
Genome map
AA seq 324 aa AA seqDB search
MTPSDGKSAYVTPIVRKLAKELGVDLSAISGTGVGGRIRRQDVEAAAEAAKASAEAAKAA
AVPAPATPAAPADGVKSQIAEKAKESASLRGTRQKMTGVRKAIAKHMIDSLQTSAQLTTV
MEVDVTRIVKLRAQAKAGFQAREGVNLTYLPFFVQAATEALKAHPIINSSVEGNEIVYHD
VEHVGIAVDTERGLFVPVIKNAGDLNIAGIAKQIADLAARTRDGKIKGDELSGSTFTITN
TGSAGAVFDTPIINQPNVAIMGTGAIFKAPGVVKDQDGNEVIAIRSKCFLSISYDHRIID
GAVASRFLRDVKFRLEEGDFNEVL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgaccccatccgatggcaagtccgcatatgtgactccgatcgtccgcaagctcgccaaa
gagctcggggtcgatcttagcgccatctccggaactggcgttggtggccgcattcgccgt
caggacgttgaggctgccgcagaagccgctaaggccagcgcggaggctgcaaaagccgcc
gctgtccccgctcctgccactcctgccgctccggccgacggcgtcaagtcgcagattgcc
gagaaggccaaggagtccgcgtcgcttcgtggcacccgccagaagatgaccggtgtgcgc
aaggcgatcgccaagcacatgatcgactcgctgcagacctcggcgcagctgaccacggtc
atggaggtcgatgtcacccgcatcgtcaagctccgggcacaggccaaggcgggcttccag
gctcgtgagggcgtcaatctcacctacctgccattcttcgtacaggcagctactgaagcg
ctcaaggcccacccgatcatcaactcctccgttgaaggcaacgagatcgtctaccacgac
gtcgaacatgtgggtatcgcggtcgacaccgagcgtggcctgttcgttccggtaatcaag
aatgccggtgacctcaatatcgccggcatcgctaagcagatcgccgaccttgcagcccgt
acgcgggacggcaagatcaagggcgatgagctctccggctccaccttcacgatcacgaac
accggttcagccggtgccgtcttcgataccccgatcattaaccagcccaacgtggccatc
atgggtacgggtgccatcttcaaggcaccgggtgtggtcaaggatcaggacggtaacgag
gtcattgccatccggtcgaagtgcttcctgtcgatctcctacgatcaccgcatcatcgac
ggcgctgtcgcctcgcgtttcttgcgcgatgtgaagttccgcctcgaagagggcgacttc
aacgaagtcctctaa

DBGET integrated database retrieval system