KEGG   Trueperella pyogenes TP8: X956_07175Help
Entry
X956_07175        CDS       T03579                                 

Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
tpyo  Trueperella pyogenes TP8
Pathway
tpyo00230  Purine metabolism
tpyo00240  Pyrimidine metabolism
tpyo01100  Metabolic pathways
tpyo01110  Biosynthesis of secondary metabolites
tpyo01130  Biosynthesis of antibiotics
Module
tpyo_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
tpyo_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tpyo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    X956_07175
   00240 Pyrimidine metabolism
    X956_07175
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tpyo04131]
    X956_07175
Enzymes [BR:tpyo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     X956_07175
Membrane trafficking [BR:tpyo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    X956_07175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AJC69838
Position
complement(1510960..1511373)
Genome map
AA seq 137 aa AA seqDB search
MSEQTLILVKPDGVQRGLTGEILRRIETKGYRIVQMRMLTATDELLAQHYHEHTEKPFYA
GMAAYMKSGPIVAAVIEGDRVIEGVRSLAGATEPTQAAPGTIRGDLGRDWGDGEIRNLIH
SSDGTESAAHEISVWFD
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaacagactttgatccttgttaagccagatggcgttcagcgcggcctcaccggc
gagatcctgcgccgcatcgaaactaagggctaccgcattgtccagatgcgtatgctcacc
gctacggatgagctcctggctcagcattaccatgagcacaccgaaaagcccttctatgcg
ggcatggcggcatacatgaaatctggacccatcgttgcggcggtcatagaaggcgaccgc
gtcattgaaggcgtgcgttcactagcaggcgcaacggaacccacccaggctgctcctgga
accattcgtggcgatctgggcagggattggggagacggtgaaatccgcaacctcatccat
tcctccgacggcactgagtcggcagcgcacgaaatctccgtctggttcgactga

DBGET integrated database retrieval system