KEGG   Thermacetogenium phaeum: Tph_c19620Help
Entry
Tph_c19620        CDS       T02276                                 

Gene name
acoC
Definition
(GenBank) dihydrolipoyllysine-residue acetyltransferase component of acetoin cleaving system
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tpz  Thermacetogenium phaeum
Pathway
tpz00010  Glycolysis / Gluconeogenesis
tpz00020  Citrate cycle (TCA cycle)
tpz00620  Pyruvate metabolism
tpz01100  Metabolic pathways
tpz01110  Biosynthesis of secondary metabolites
tpz01120  Microbial metabolism in diverse environments
tpz01130  Biosynthesis of antibiotics
tpz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tph_c19620 (acoC)
   00020 Citrate cycle (TCA cycle)
    Tph_c19620 (acoC)
   00620 Pyruvate metabolism
    Tph_c19620 (acoC)
Enzymes [BR:tpz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Tph_c19620 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding RnfC_N Biotin_lipoyl_2 Ntox10 SHS2_FTSA
Motif
Other DBs
NCBI-ProteinID: AFV12156
UniProt: K4LGL4
Position
complement(1984016..1985173)
Genome map
AA seq 385 aa AA seqDB search
MAAQITMPKLGLSMKTGTVAKWLKNEGDRVKKGEPVVEIMTEKITNTVEAPEEGILLKIV
ASKGAKLPIGALLGVIGSEGEDISALLAEAPGGTAAAASAAPAAGERIKISPAARKLAEE
NGIDYTRIKGTGPEGRITREDVERAIAEGIPAADDRPTLEVIPYEGMRRAIGDNMAHSWA
VAPKVTHHTSVDLSGIIALRREINEGVKEKDKVSITAFLVKAVAKALELKPAVNATLDGE
EIKVLQDINIGVAVALPDGLIVPVVRNADQKDIYQVNKEIRDLAKRARRNKLEPDEMTGG
TFTVTNLGAYGSVDWFTPIINQPESAILGVGRTVERPVVVNGEITIRPMLGLSLAFDHRV
IDGAPAAEFLKVLIDLIEKPYRIFI
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atggcagcacagataaccatgcctaaattaggactgtccatgaagacgggcactgtcgcc
aaatggctgaaaaacgaaggggatcgcgttaaaaaaggggagccggtcgtggagatcatg
accgaaaagatcaccaacacagtggaagcgccggaagaaggcatactgcttaaaattgtc
gcttcaaaaggtgcgaagcttccgattggggctttgcttggggtgattggctccgaaggc
gaggacatatccgccctgcttgcagaggcgcctggcgggacggcagctgctgcttcggcc
gcaccggcagcaggtgagaggataaagatctccccggctgcccggaagctggcagaagaa
aacggtatcgattacacccgtattaaaggaacgggtcctgaggggcgcatcaccagagaa
gatgtggagagggccatcgccgaggggattcctgcggcggatgaccggccgacccttgag
gttattccttacgaaggcatgagacgggctattggcgataacatggcccatagctgggcg
gtagcgcccaaggttacccaccataccagtgtggacctttcaggcatcatcgccctccgc
cgagagatcaatgagggggttaaggaaaaagacaaggtttctattactgcctttttggtt
aaggctgttgcaaaggctttagaactcaagccggcggtgaatgccaccctagacggggaa
gagatcaaggtgcttcaggatatcaacatcggggtggcggtggccctgccggatgggctg
attgtcccggttgttagaaacgccgaccaaaaggacatctaccaggttaataaggaaatc
agggatctggccaaacgcgcacgccgcaacaagctagaaccggacgagatgaccggcggc
accttcaccgttaccaacctgggagcctacggctcggtggactggttcaccccgatcatc
aaccagccggagtcggctatactgggtgtcggccgtacggtagagcggccggttgtggtg
aacggggagatcaccatccggcctatgctgggactctccctggcttttgatcaccgagtg
attgacggcgcccctgctgccgagtttttaaaggtcttgatcgatctgatcgaaaaacca
taccgcatatttatttag

DBGET integrated database retrieval system