KEGG   Thermacetogenium phaeum: Tph_c19660Help
Entry
Tph_c19660        CDS       T02276                                 

Gene name
bdhA
Definition
(GenBank) (R,R)-butanediol dehydrogenase BdhA
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
tpz  Thermacetogenium phaeum
Pathway
tpz00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:tpz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Tph_c19660 (bdhA)
Enzymes [BR:tpz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     Tph_c19660 (bdhA)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     Tph_c19660 (bdhA)
    1.1.1.-  
     Tph_c19660 (bdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_N_assoc ADH_zinc_N_2 2-Hacid_dh_C TrkA_N DAO FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AFV12160
UniProt: K4LJM7
Position
complement(1988249..1989307)
Genome map
AA seq 352 aa AA seqDB search
MKAAVWYGKKDVRVVDVPEPPAPKPGWVKVEVEWCGICGSDLHEYIAGPIFIPVDKPHPL
TGGTAPVILGHEFSGTVVEVGEGVKNVKVGDRVAPDACQVCWECYSCKRYDYPCCEKLAF
TGLHTDGAFARYVNVPAYTIYKIPDTMTFEQAALVEPISVGMHAVRRAPVIAGNNVVVIG
AGTIGLSALQCARVAGAAQVIVIEVAKARKEYAKKLGATAVLDPTQCDVVAEVFKLTDGI
GADVSIECVGSDKTTPLSLAVLRPRGISVQAGVFERESSINFNGIVFPEKEIKGSLAYNG
EFAPVIKMIDDGRLNADMMITGRIKLDEIIEKGFEELINNKDENIKIIVSPK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgtatggtacggaaaaaaagatgtcagagtggtggatgttccggaaccg
ccggcaccaaagcccggttgggtcaaggttgaggtggaatggtgtggcatttgtggatca
gatctacacgaatacattgctggtcccatctttattcccgttgacaagcctcatccctta
acaggtggtactgctcccgtaatcttgggccatgagttctccggtacagttgtggaagtc
ggcgaaggggttaagaatgtcaaggttggggacagggtagctcccgatgcctgccaggta
tgctgggagtgctactcttgcaagagatatgattatccgtgctgtgagaagctggcattc
accggtctgcacaccgacggtgcttttgcacgttatgtcaatgttcccgcatataccatt
tacaaaattcccgacaccatgacctttgaacaggcagcactggtagagcccatctccgtt
ggtatgcatgccgttcgccgggccccggttattgccggtaataacgtagtagttatcgga
gccggtactatcggactgtccgccctgcagtgcgccagggttgccggagcggcccaggta
attgtgattgaggtggccaaagcccgcaaggaatatgccaagaaactcggtgctactgct
gttcttgatcccactcagtgtgacgttgtggcggaagtctttaagcttacggacggcatc
ggtgccgatgtgagcatcgagtgtgtcggtagtgataagaccactccgctttcgcttgca
gtcctccgtccgcgcggtatttctgttcaggctggagtgttcgagcgcgagagcagcata
aacttcaacggaatcgttttccctgaaaaagagatcaagggttcactggcatacaacggg
gagtttgcccctgtgatcaagatgattgatgacggccgcctcaatgcagacatgatgatc
accggcaggatcaagctggatgaaattatcgaaaaggggttcgaggaattaatcaacaac
aaggacgagaatatcaagattatcgtatctcccaaataa

DBGET integrated database retrieval system