KEGG   Thermacetogenium phaeum: Tph_c20250Help
Entry
Tph_c20250        CDS       T02276                                 

Definition
(GenBank) methylaspartate ammonia-lyase
  KO
K04835  methylaspartate ammonia-lyase [EC:4.3.1.2]
Organism
tpz  Thermacetogenium phaeum
Pathway
tpz00630  Glyoxylate and dicarboxylate metabolism
tpz00660  C5-Branched dibasic acid metabolism
tpz01100  Metabolic pathways
tpz01120  Microbial metabolism in diverse environments
tpz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Tph_c20250
   00660 C5-Branched dibasic acid metabolism
    Tph_c20250
Enzymes [BR:tpz01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.2  methylaspartate ammonia-lyase
     Tph_c20250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MAAL_C MAAL_N MR_MLE_C Enolase_C
Motif
Other DBs
NCBI-ProteinID: AFV12219
UniProt: K4LW34
Position
complement(2047971..2049227)
Genome map
AA seq 418 aa AA seqDB search
MRIEKVLASPGLTGFFFDDQLAIKMGAREDGAAYRGEPRTPGFTSVRQRGESLSIMLLLS
GGEVAYGDCAAVQYSGAGGRDPLFLAESYIPLVEEYLGERLAGREITGFREMAEEIGSFT
TRDGRRLHTAVLYGLTQALLHAVALKERRLMCEVLSDEYGTGLTLEPVPVFAQTGDERFT
NADKAIIKRADVLPHGLINNVDSKLGRNGEKLCDYVGWLSRRARELAGEDYRPVLHIDVY
GTLGLAFDNDLERIADYLARLERAAAPLKLRIEGPIDMGSKAGQIEGLQRLKVLLVVKGV
SVEIVADEWCNTLEDVRDFVNAGAAHMVQVKTPDLGGINNTVEAVIYAKERGCGAYLGGT
CNETDRSARVCVHIALATRPDQMLAKPGMGVDEGMMVVVNEMQRALRILRYKRGGDVI
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcgaaaaggtattggcatctccggggctgactggttttttctttgacgaccag
ctggcgatcaaaatgggcgcccgggaagacggagcggcctaccgcggggaaccgcgcacc
cccggatttacctccgtcaggcagcggggggagtctctcagcatcatgctgctcctctcc
gggggggaggtggcctacggggactgcgccgccgtgcagtactcgggcgccggggggcgg
gatccgctgtttctggcggaaagctacattcccctggtggaggaatacctcggagaaagg
cttgcagggagagagatcacgggattccgggagatggcggaggagatcggctcctttacc
acaagggacggcaggcgcctgcacaccgccgttctctacggattgacccaggctctgctc
catgccgtcgccctcaaagagcgcaggctgatgtgcgaggtgctctccgacgaatacgga
accggcctgaccctggagcccgttccggtcttcgcccagaccggtgacgagcggtttacc
aacgcggataaggctatcatcaagcgggccgacgttctgccgcacgggctgatcaacaac
gtggattcgaagctgggcaggaacggggaaaaactctgtgattacgtcggctggttgagc
aggcgggcgcgggagctggcaggggaggactaccgccccgtcttgcacatcgacgtctac
ggtactctggggctggcctttgacaacgatctcgagcggatcgccgattacctggcccgt
ctggagagggcggccgctcccctcaagctgcggatcgagggccccatcgacatgggctcc
aaagccgggcagatagagggcctgcaaagactgaaggttttgctggtcgtcaagggggta
tcagtggagatcgttgccgacgagtggtgcaacaccctcgaagacgtccgggacttcgta
aatgccggggccgcccatatggtacaggtcaagacgccggacctggggggtattaacaac
accgtggaggccgtcatctacgccaaggagcgcggctgcggtgcctatctggggggaacc
tgcaatgagaccgaccgctccgccagggtctgtgtccatatagccctggccacccgaccc
gaccagatgctggccaagcccgggatgggggtggatgaagggatgatggtggtcgtcaat
gaaatgcagagggccttgcggatcctgcgctataaaagaggcggggatgtgatttag

DBGET integrated database retrieval system