KEGG   Thermacetogenium phaeum: Tph_c26490Help
Entry
Tph_c26490        CDS       T02276                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha subunit TrpA
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tpz  Thermacetogenium phaeum
Pathway
tpz00260  Glycine, serine and threonine metabolism
tpz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tpz01100  Metabolic pathways
tpz01110  Biosynthesis of secondary metabolites
tpz01130  Biosynthesis of antibiotics
tpz01230  Biosynthesis of amino acids
Module
tpz_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tpz00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tph_c26490 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tph_c26490 (trpA)
Enzymes [BR:tpz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tph_c26490 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA EBV-NA1 PcrB
Motif
Other DBs
NCBI-ProteinID: AFV12817
UniProt: K4LL94
Position
complement(2667536..2668351)
Genome map
AA seq 271 aa AA seqDB search
MQENRIDARLRRLRRSGEKGLITFITAGDPDLETTSRLVLAMEEAGADMVELGVPFSDPL
ADGPVIQRASQRSLNGGTNLEGILMMVRELRRRTEIPLLLMTYYNPVLQYGLKRIAAEAG
AAGVDGFIVPDLPLEESRPLLDELGRSGLHLVPLVAPTTTERRLEEADRVAGGFIYCVSL
TGVTGMREEVPPGIVQFIERVRRCCRLPLGIGFGVSGPRQAALMARLADAVIVGSAIVHL
VEKYATQPPLLLDRVSGLVRELKEAVRTCRG
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgcaggagaaccgcatcgatgcccggctgcggcggctgcgccggagcggtgaaaagggc
ctgatcacctttattacggcaggggaccccgacctggaaacaacatccaggctggtgctg
gccatggaggaggcgggtgcggacatggtggagctgggtgtgcccttttccgatcccctg
gccgacgggccggtaatccagcgggcatcacagcgctccctgaacggcggcaccaacctg
gaggggatattgatgatggtgcgggagctgcgccggcggacggagatccccctgcttctg
atgacctattacaacccggtgctccagtacgggctgaagcggatcgctgccgaggcaggg
gcggcgggtgtggacggcttcatcgtccccgacctgcccctggaggagagccgtccgctg
ctcgatgagttgggcagatcggggctgcacctggttcccctggtggcccctacgaccacc
gaaaggcggctggaagaggccgaccgggtggccggagggtttatctactgcgtctctctg
accggtgtgaccggaatgcgggaagaggtaccgcccggcatcgtgcagttcatagagagg
gtgcggaggtgttgccggctgccgctgggcattggcttcggagtttccggtccccggcag
gcggccctgatggcccggctggcggatgcggtgatcgtggggagcgccatcgtccacctt
gtggagaagtatgcgacgcagccgccgctgctgctggatagggtatccggcctggtgcgg
gagttgaaggaggcggtccgcacctgccgcggctaa

DBGET integrated database retrieval system