KEGG   Thermacetogenium phaeum: Tph_c26520Help
Entry
Tph_c26520        CDS       T02276                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase TrpC
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tpz  Thermacetogenium phaeum
Pathway
tpz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tpz01100  Metabolic pathways
tpz01110  Biosynthesis of secondary metabolites
tpz01130  Biosynthesis of antibiotics
tpz01230  Biosynthesis of amino acids
Module
tpz_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tpz00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tph_c26520 (trpC)
Enzymes [BR:tpz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Tph_c26520 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C His_biosynth FMN_dh
Motif
Other DBs
NCBI-ProteinID: AFV12820
UniProt: K4LLK6
Position
complement(2670235..2671053)
Genome map
AA seq 272 aa AA seqDB search
MILKRIVDAKREEVAFFRSLLPLRELRRRVAAAPPVRDFLGAVRRKGATVNLIAEIKRAS
PSRGLLRPDFNPPEIACAYEKAGVQAISVLTDEGFFGGHPKHLREVRRVTRLPLLRKDFI
IDHYQLYQSRLLGADAVLLIAALLEQARLVDFLGLAGELGLTALVEVHTPEELFRALETG
AALVGINNRDLRTFQTDLGVTLRLLPLVPEGTVAISESGIRNRRDVMRLARAGVDALLVG
ETLMRSRDIGAAVAELMGDEDEDAVDPAGRRG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgattctgaaacgcattgtggatgccaaacgggaggaggtggccttctttcggagtctc
cttcccctcagggaattgaggaggcgggttgctgcggctccgcccgtccgcgactttttg
ggggcggtacggcggaaaggggcgacggtcaatttgatcgccgagatcaagcgggcctcc
ccctcgcgcgggctgctgcggccggatttcaacccgccggagatcgcctgcgcctacgaa
aaagcgggggtgcaggccatctccgttctcaccgatgaggggtttttcggcggccatcct
aagcacctgcgggaggtaagacgggtgacccgacttcccctgctgcgcaaggacttcatc
atcgatcactatcagctctaccagtcccgcctcctgggggcggatgccgtgctgctgatc
gccgcccttctggagcaggcacggctggtcgattttctcggcctggccggtgagctgggg
ctgaccgccctggtggaggtgcacaccccggaggagcttttccgggcgctggaaacaggg
gctgctttggtggggatcaacaaccgcgacctccgcacctttcaaacggatctgggagtc
accctcaggttgctgccgctggtgcctgagggaacggtggccataagcgagagcggtatc
cgcaaccgaagggatgtaatgaggctggcgcgagcgggtgttgatgcactgctggtgggg
gagaccctgatgcgctcccgcgatatcggagcggcggtggcagagttgatgggtgatgaa
gatgaggatgccgtcgatcccgccggccggagaggatga

DBGET integrated database retrieval system