KEGG   Thermacetogenium phaeum: Tph_c27630Help
Entry
Tph_c27630        CDS       T02276                                 

Gene name
aor6
Definition
(GenBank) tungsten-containing aldehyde ferredoxin oxidoreductase Aor
  KO
K03738  aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
tpz  Thermacetogenium phaeum
Pathway
tpz00030  Pentose phosphate pathway
tpz01100  Metabolic pathways
tpz01120  Microbial metabolism in diverse environments
tpz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tpz00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tph_c27630 (aor6)
Enzymes [BR:tpz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Tph_c27630 (aor6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_C AFOR_N
Motif
Other DBs
NCBI-ProteinID: AFV12928
UniProt: K4LJ72
Position
complement(2779669..2781558)
Genome map
AA seq 629 aa AA seqDB search
MPYGFNNRILHVDLTGKNISVEEPGENFYRTYGGGPGIALYYMLKDMPPGVDPLGPENLL
VFAPGLLTGTVAPCVPRYTVCARSPLTGAFGKSEAGGWWGPELKAAGYDAIVIKGQAEAP
VYLWIDDGKVEIRDAGKIWGLETGTAAAAIKEELGDERVRIAQIGPAGENLVRYAAILNE
LGHFNGRNGLGAVMGSKKLKAIAVRATGRVEVCDPQRLKELSRWVSAEAKVHPLSKALHD
MGTPGGVEGNNAAGALPTRNWTNGTFEGYEEISGTRLNQEILVKRGGCFSCPVRCKRVVR
VSGEYDVDPRYGGPEYEALASLGSSCGISDLRLVAKANEVCNRYGLDVISAGLTIAFAME
CFENGLLTLEDTGGLELRFGNKGIFLELLRLIAYREGFGEWLADGSVALAKRIGKGSERF
LMHVKGQELPMHDPRVKTGFGMQYALAPQGADHQYAQHDPFFVPGNPLGQKAGRPLGILE
GVPATDLSWRKVRTILYTSFLNFSYDSLGACVFGFIARSVTPYNILLEIIEAVTGWETSL
WELMKTGERLNTMARLFNCREGFGRDDDRIPERLFTPLKSGPNKGSLAIPPDDFRKALDL
YYAMAGWDEAGRPRQGKLLELGLDWLAGV
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
gtgccatacgggttcaacaacaggatactgcacgtcgacctgacgggaaaaaacatatcc
gtcgaggaaccgggggagaacttttaccgcacctacggcggggggccggggatcgccctt
tactacatgctgaaggacatgccccctggcgtcgaccccctggggccggaaaacctgctg
gttttcgcaccggggctgctgacgggaacggtggcgccctgtgtaccccgctatactgta
tgcgccaggtcaccccttacaggcgcctttggtaagtctgaggcggggggatggtggggg
cctgagctgaaggcggccgggtatgacgccatagtcatcaaggggcaggcggaggctccc
gtctacctctggatcgacgacggcaaggtggaaatccgggacgccgggaaaatctggggc
ctggagaccgggacggccgctgctgccattaaggaggagctgggggatgagcgggtgcgg
atcgcccagatcgggcctgcaggagagaacctcgtccgctacgcggccatcctcaatgag
ctggggcacttcaacgggcgcaacggtctgggggcggtgatgggttccaagaagctgaag
gccatcgccgtgcgcgcaaccggaagggtggaggtctgcgatccgcaaaggctcaaagag
ctctcccgctgggtttcggcggaggccaaggtccatccgttgagcaaagccctgcacgac
atgggcacacccggtggtgttgaggggaataacgctgcaggggcgcttcctacccgcaac
tggaccaatggaaccttcgaggggtatgaggaaatctccggcaccaggctcaaccaggag
atcctggtcaagcggggagggtgcttctcctgcccggtgcgctgtaaacgggtcgtgagg
gtttccggggagtacgacgtcgatccccgttacggcgggccggagtacgaggccctggcc
tccctgggttccagctgcggaatctccgacctgaggctggttgccaaggccaatgaggtt
tgcaacagatacggcctcgatgtcatttccgccggattgacgattgcctttgccatggag
tgctttgagaacgggctgctcacccttgaagataccggcggcctggagctgcgattcggc
aacaagggtatctttctggagctgctgcgattgatcgcctaccgggaggggttcggggag
tggctggccgacggttcggtcgccctggcgaagaggatcggcaagggctcggaaaggttc
ctgatgcacgtcaaaggacaggagcttcccatgcacgaccccagggtcaaaaccggattc
gggatgcagtacgccctggccccgcagggtgccgaccatcagtacgcccagcacgatccc
ttcttcgttcccggaaatcccctggggcagaaggcaggacgccctctcgggattttagag
ggggttccggcaacggatctctcctggcggaaggtgagaactattctctataccagtttt
ctcaatttcagctacgattccctgggtgcctgcgtttttgggtttatcgcccgcagtgtt
acgccttataatattctattggagatcatcgaggcggtgaccggctgggaaaccagctta
tgggaattgatgaagaccggcgaaaggcttaacactatggcccggctgttcaactgtcgg
gaggggttcgggcgtgatgatgaccgcataccggagcgtcttttcacccccttaaagagc
ggccccaacaaagggagtctggccataccgcctgatgatttccggaaggccctggatctg
tactacgccatggccggctgggatgaagcgggcaggccgcgtcagggaaaactgctggaa
ctggggttggactggctggccggggtgtaa

DBGET integrated database retrieval system