KEGG   Thermacetogenium phaeum: Tph_c27830Help
Entry
Tph_c27830        CDS       T02276                                 

Gene name
fba
Definition
(GenBank) fructose-bisphosphate aldolase Fba
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
tpz  Thermacetogenium phaeum
Pathway
tpz00010  Glycolysis / Gluconeogenesis
tpz00030  Pentose phosphate pathway
tpz00051  Fructose and mannose metabolism
tpz00680  Methane metabolism
tpz01100  Metabolic pathways
tpz01110  Biosynthesis of secondary metabolites
tpz01120  Microbial metabolism in diverse environments
tpz01130  Biosynthesis of antibiotics
tpz01200  Carbon metabolism
tpz01230  Biosynthesis of amino acids
Module
tpz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tpz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tph_c27830 (fba)
   00030 Pentose phosphate pathway
    Tph_c27830 (fba)
   00051 Fructose and mannose metabolism
    Tph_c27830 (fba)
  09102 Energy metabolism
   00680 Methane metabolism
    Tph_c27830 (fba)
Enzymes [BR:tpz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Tph_c27830 (fba)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase FMN_dh
Motif
Other DBs
NCBI-ProteinID: AFV12948
UniProt: K4LJ91
Position
complement(2802861..2803715)
Genome map
AA seq 284 aa AA seqDB search
MGLVTCAEILASAEAGGYAVGAFNCNNMEIVQAIIRAAEAERSPVIIQASQGAIKYAGMG
YIVALIREAAASASVPVAMHLDHGTDFQQVMLCIRNGFTSVMIDGSHHPLSENIDITKRV
VEVAHAVGVSVEGELGRIRGVEDEVRVSEREAFFTDPEEARIFVRETGVDALAPSIGTAH
GRYRGKPELDFDRLAQIRKLTGVPLVLHGSSGVPGEDIRRAISLGVRKVNIDTDIREAFV
AEVRRRLEADPSEIDPRRILGPAREKACQVIREKIRLFGSAGKA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
ttgggtctggtcacatgtgcggaaatactcgccagcgccgaagcaggcggttacgcagtc
ggcgcctttaactgcaacaacatggagatcgttcaggctattattcgggcggccgaggcc
gaacgctctccggtgattatccaggcgagccagggtgccatcaagtacgcgggtatgggc
tatattgtggccctgatccgggaggctgccgcttctgccagtgtgcctgtggccatgcac
ctcgaccacggaacggactttcagcaggtgatgctctgcatcaggaacggctttacatcg
gtcatgatcgacggatcgcaccacccgttaagtgagaatatcgacatcaccaaaagggtc
gtcgaggtcgcccatgcggtaggggtctctgtggaaggggaactgggccgcatccggggt
gtagaggatgaggtccgggtttccgagcgagaggctttctttaccgatccggaagaggcg
agaatctttgtgcgggagaccggggttgatgccctggccccgtctatcggaaccgcccac
gggcgctaccgcgggaaacctgagctggacttcgaccgactggcgcagatcagaaaactg
actggggtacctttggtgctgcacggctcctcgggtgtccccggcgaggatatcagaagg
gcgatctccctgggggtgcggaaggtgaatatcgataccgacatccgggaggcctttgtg
gccgaggtccgccgacgcctggaggccgatccttcagagatcgacccccgccggatttta
ggccccgctcgggagaaggcctgtcaggtgatcagggagaagattcggctcttcggctcc
gcgggcaaggcatag

DBGET integrated database retrieval system