KEGG   Truepera radiovictrix: Trad_0356Help
Entry
Trad_0356         CDS       T01254                                 

Definition
(GenBank) succinate dehydrogenase, membrane subunit (SdhD)
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
tra  Truepera radiovictrix
Pathway
tra00020  Citrate cycle (TCA cycle)
tra00190  Oxidative phosphorylation
tra00650  Butanoate metabolism
tra01100  Metabolic pathways
tra01110  Biosynthesis of secondary metabolites
tra01120  Microbial metabolism in diverse environments
tra01130  Biosynthesis of antibiotics
tra01200  Carbon metabolism
Module
tra_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tra_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tra_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Trad_0356
   00650 Butanoate metabolism
    Trad_0356
  Energy metabolism
   00190 Oxidative phosphorylation
    Trad_0356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt DUF1691 DXP_redisom_C
Motif
Other DBs
NCBI-ProteinID: ADI13495
UniProt: D7CRK5
Position
402562..403020
Genome map
AA seq 152 aa AA seqDB search
MAVRAPRTLRDARATYTTNGELAWWVFMRVSGLALIFLTFGHLYMSNIVIDAGQIDFSYV
ARRLSITWVKIYDTLLLGLAVLHGVNGARYSIEDYARHPGWRFGIKMGLYSATVLVMIIG
IISLWAVDYTQYLNLPPDAMPGAAPGAVAPGH
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggcggttcgcgcaccacggacgctgcgcgacgcgcgcgcgacctacactaccaacggc
gagctcgcttggtgggtattcatgcgcgtgtcggggctcgcgctcatcttcctgaccttc
ggccacctctacatgagtaacatcgtcatcgacgccggtcagatcgactttagctacgtc
gcgcggcggctctcgatcacctgggtcaagatctacgacacgctcctcttggggctcgcc
gtgctccacggggtcaacggcgcgcgctacagcatcgaggactacgcccgccacccgggg
tggcgcttcggtatcaagatggggctctactcggctaccgtgctggtcatgatcatcggc
attatctcgctctgggcggtcgactacacccagtacctcaacctgccgccggacgcgatg
ccgggtgcggcgcctggcgccgtggcgccggggcactag

DBGET integrated database retrieval system