KEGG   Truepera radiovictrix: Trad_0457Help
Entry
Trad_0457         CDS       T01254                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tra  Truepera radiovictrix
Pathway
tra00010  Glycolysis / Gluconeogenesis
tra00051  Fructose and mannose metabolism
tra00562  Inositol phosphate metabolism
tra01100  Metabolic pathways
tra01110  Biosynthesis of secondary metabolites
tra01120  Microbial metabolism in diverse environments
tra01130  Biosynthesis of antibiotics
tra01200  Carbon metabolism
tra01230  Biosynthesis of amino acids
Module
tra_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tra_M00002  Glycolysis, core module involving three-carbon compounds
tra_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tra00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Trad_0457
   00051 Fructose and mannose metabolism
    Trad_0457
   00562 Inositol phosphate metabolism
    Trad_0457
Enzymes [BR:tra01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Trad_0457
Exosome [BR:tra04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Trad_0457
  Exosomal proteins of bladder cancer cells
   Trad_0457
  Exosomal proteins of melanoma cells
   Trad_0457
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADI13594
UniProt: D7CS62
Position
complement(501925..502677)
Genome map
AA seq 250 aa AA seqDB search
MKPLIAANWKMHKLPSEVTAWASDFEAALADTDRSRFDLAICAPFTHLSALAAALDGTGV
AVGAQDVSSHAEGAYTGEVSAAMLKDLGVRYVIVGHSERRAYHHEDDALVRGKLERVLES
GMTPILCVGETLQEREGGRAREVTLGQLRGALEGVALGNAGGLVVAYEPVWAIGTGKTAT
DADAQEMCGAIRAALKELLPELGGAVRILYGGSMKGDNAAGLLAQPDIQGGLVGSASLDA
RSLAQIAAAC
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccctcatcgcagccaactggaagatgcacaaactcccgagcgaggtcaccgct
tgggcaagcgactttgaggcggcgctagcggacaccgaccgcagccgtttcgatctcgct
atctgcgcgccctttacgcacctcagcgcgctcgccgcggcgctcgacggtacgggcgtc
gccgtcggcgctcaggacgtaagctctcacgccgagggggcctacaccggcgaggtctcc
gccgcgatgcttaaagacctcggcgtgcgctacgtcatcgtggggcactccgagaggcgc
gcctatcaccacgaagacgacgcgctggtgcggggcaagctcgagcgggtgctcgaaagc
ggtatgaccccgatcctctgcgtcggtgagaccctgcaggagcgcgaaggggggcgcgcg
cgggaggtgacgctcgggcaactccggggtgcgctagagggggtcgcgctgggcaacgct
ggtgggctcgtggtcgcttacgaacccgtgtgggccatcggcaccggcaagaccgcgacc
gacgccgacgctcaggagatgtgcggcgccatccgcgcggcgctcaaagagctcttgccg
gagctagggggggcggttcgcatcctctacggcggctcgatgaagggcgacaacgccgcc
gggctgctcgcgcaacccgacatccagggcgggctcgtgggcagcgccagcttggacgct
cggtcgctcgcccagatcgccgcggcatgctag

DBGET integrated database retrieval system